KEGG   Cellulosilyticum lentocellum: Clole_2175Help
Entry
Clole_2175        CDS       T01448                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cle  Cellulosilyticum lentocellum
Pathway
cle00010  Glycolysis / Gluconeogenesis
cle00053  Ascorbate and aldarate metabolism
cle00071  Fatty acid degradation
cle00280  Valine, leucine and isoleucine degradation
cle00310  Lysine degradation
cle00330  Arginine and proline metabolism
cle00340  Histidine metabolism
cle00380  Tryptophan metabolism
cle00410  beta-Alanine metabolism
cle00561  Glycerolipid metabolism
cle00620  Pyruvate metabolism
cle00625  Chloroalkane and chloroalkene degradation
cle01100  Metabolic pathways
cle01110  Biosynthesis of secondary metabolites
cle01120  Microbial metabolism in diverse environments
cle01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clole_2175
   00053 Ascorbate and aldarate metabolism
    Clole_2175
   00620 Pyruvate metabolism
    Clole_2175
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Clole_2175
   00561 Glycerolipid metabolism
    Clole_2175
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Clole_2175
   00310 Lysine degradation
    Clole_2175
   00330 Arginine and proline metabolism
    Clole_2175
   00340 Histidine metabolism
    Clole_2175
   00380 Tryptophan metabolism
    Clole_2175
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Clole_2175
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Clole_2175
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Clole_2175
Enzymes [BR:cle01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Clole_2175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ADZ83889
UniProt: F2JR31
Position
complement(2388918..2390273)
Genome map
AA seq 451 aa AA seqDB search
MSSISQCVQDMNHYFYTRKTYDLKLRTYYLKKFKSAILNHQKEIEKALHKDFKKPAFETY
LTEIYTTISEINHTLKNLKNWSKPLQYKGVLPVIGGNTKVLKEPYGICLIFSPFNYPFQL
AMMPLIGAIAAGNCAIVKPSEYTPATNKVLRMILNEVFPPYYVTLVEGDSMVCTELLNEP
LDYVFFTGGIETGKKVMKQASEHLIPVTLELGGKSPVIVDHTADLRLAATRIVWGKFLNA
GQTCVAPDYVLVHESVADRLLCYIGFVLQHFYREKKHMAHIINEAHYVRLLQLINEDKIH
FGGHFNTDELYIEPTVLYPVAPSDLCMQEEIFGPILPIIPYKRLEEAIHYVQRYPKPLAC
YLFSKDQKRIDYLLKHLSFGGGCINDTILHVTHPQAPFGGVGYSGMGAYHGYNSFRTFTH
EKTVLYSTPRELPFRYPPYDKQLKWIKKMIR
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctatttcacaatgtgttcaagatatgaatcattatttttatacccgaaaaact
tatgatttaaaacttcgtacgtattacttaaaaaaatttaaaagtgctattttgaatcat
caaaaagaaattgaaaaagcgcttcataaagattttaaaaagccagcttttgaaacttac
ttaactgaaatttatacaacaatttcagaaatcaatcatacacttaagaatcttaaaaac
tggtcaaagcctttacagtataaaggagtacttccggttataggtggcaatacaaaagta
ttgaaagaaccctatggtatatgtcttattttttcaccttttaactacccttttcaatta
gcaatgatgcctcttattggagctattgcagcaggcaattgtgccattgttaagccttca
gaatatacaccagctacgaataaagtacttcgtatgattttaaatgaagtttttccaccc
tactatgtaacacttgtggaaggtgatagcatggtgtgtactgaacttcttaacgaacca
ctagattatgtttttttcaccggtggcatagaaacgggtaaaaaggtaatgaaacaggca
tctgaacatttaatccctgtaactttagaactaggtgggaaaagccctgttattgtagat
catacagctgatttacgtttagcagctactcgtattgtatggggtaaatttttaaatgca
ggacaaacctgcgtagctccagactatgttcttgttcatgaaagtgtagcagatcgcttg
ttatgttatataggttttgtattacaacatttttacagagaaaaaaagcatatggcacat
attattaatgaagcacattatgttcgtttacttcaacttataaatgaagataaaatacat
tttggtggacattttaatacagatgaattatatattgaaccaacagttctgtaccctgtc
gcaccttctgacttatgtatgcaagaagaaatttttggccctattttgcctattatacct
tataagcgtttagaagaagctattcattatgtccaacgttatcctaagccactagcatgc
tatctttttagtaaagaccaaaaacgtattgactatttacttaaacatctttcttttgga
ggtggttgtattaatgatacaatattacatgttactcacccacaagctccttttggtggg
gtaggttatagtggaatgggggcatatcatggttacaatagttttagaacctttactcat
gagaaaaccgttctttatagtactcctagggagcttccttttcgttatcccccttatgat
aaacaattaaaatggattaaaaaaatgattcgataa

DBGET integrated database retrieval system