KEGG   Cellulosilyticum lentocellum: Clole_3323Help
Entry
Clole_3323        CDS       T01448                                 

Definition
(GenBank) Beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
cle  Cellulosilyticum lentocellum
Pathway
cle00052  Galactose metabolism
cle00511  Other glycan degradation
cle00600  Sphingolipid metabolism
cle01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Clole_3323
  Lipid metabolism
   00600 Sphingolipid metabolism
    Clole_3323
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Clole_3323
Enzymes [BR:cle01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Clole_3323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Glyco_hydro_2_N Glyco_hydro_2 BetaGal_dom4_5
Motif
Other DBs
NCBI-ProteinID: ADZ85014
UniProt: F2JQN0
Position
3597222..3599666
Genome map
AA seq 814 aa AA seqDB search
MKKYINNHWIFTEHYSPELHKPGFTKGLKVRLPHTCKETPFHYFDENLYQMTCWYKTELD
IPADWNGDYVAVTFEGVAHQADVFVNGVKIYSHYCGYTAFTVDISSSIKYGETNVLVVKV
DSHEQLNQPPFGHVIDYMTFGGIYREVYLEHKPTLHIADIFVKPEILTDKIESTNLDTKV
SAQVSSDITLSAIDVPVKLEQLLYSTSEEKTPLATYTCSDCHPTFTVDNVSLWDIDTPVL
YQLVTRLYDMSQKTPQLLDTVTTTIGFRRSEFKKDGYYLNGRKLKIRGLNRHQSYPYVGY
AMPASMQKLDADILKNELGVNAVRTSHYPQSHHFIQRCDEIGLLVFTEIPGWQHIGDDTW
KKQAVINTTDMVRQYRNHPSIILWGVRINESQDDDAFYLATNKAAHEADPTRPTGGVRAI
AHSHLLEDVYTYNDFIHDGVKRGCQPKQKVTSNNHKPYLITEYCGHMYPTKTYDDEAHKR
EHARRHANILDAVASENEIAGSFGWCMFDYNTHRDFGSGDRICYHGVMDMFRNPKPAAYV
YAALGNRNPVLEISSSMDIGEHPGCIRGDIYIYTNADSVRFYKNNELIKEFFNRDSTYSH
LSHGPITMNDFIGDKMGKQEHFSSRQEALVKDLINAYALKGADCMTLGLMLKALALMAIY
RMKPADALRLYNQYIGDWGGTATTYRFDAITNGKVVKSITKAPMTSIHLKGTTNTQMLTE
SDTYDVASIRLSATDEYGNVLPYYSGYAHITCEGAIALIGPDILPFQGGYSGCYVKTIGS
EGQGSVTVSIPETDPVTFTFHVTCKNNANQNGGL
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatatataaacaatcattggatttttacagaacactattcacctgagcttcat
aaacccggatttacaaaaggcttgaaagtaagacttccacacacctgcaaagaaacaccc
tttcattactttgatgaaaacctctatcagatgacatgctggtacaaaacagaactggat
attccagcagactggaacggtgattatgtagctgtgacatttgaaggcgttgcacatcaa
gctgatgtatttgtgaatggcgtcaaaatatattcccattattgtggctatacagccttt
acagtagatataagctccagcataaagtacggcgaaacaaatgtactggtcgtaaaggtt
gattcccatgagcaattaaatcagccaccttttgggcatgtcatagattatatgacattt
ggtgggatataccgtgaagtctatttagagcataagccaactcttcacattgcagatatc
tttgtgaaaccggagatcttaacggataaaatagaatctaccaacttggatacgaaagtt
tctgcacaggtctcaagtgatattacattatccgctattgatgtcccagtaaaattagaa
caactattatacagtacctctgaagaaaaaacaccgttagcaacatacacctgttcagac
tgtcatccaacatttacggtggacaatgtcagtctgtgggatatagatacccccgtgctt
tatcaattagtcactcgtctgtatgacatgtcgcaaaaaacaccccagttactggacaca
gtgactacgacaataggattcaggcgttctgaatttaagaaagacggctattatttaaac
ggacgcaagttaaagatcagggggctcaataggcaccagagttatccttatgtaggctat
gccatgcctgcttcaatgcagaaactggatgcagatatcttgaaaaacgagcttggtgta
aatgcggtaagaaccagccattatccacaatcacatcacttcatacaaagatgtgacgaa
atagggcttctggtatttactgagattcccggctggcaacatataggcgatgacacatgg
aaaaagcaggcggtaatcaatacaacagatatggtcagacaatatagaaatcatccatcc
atcatattatggggtgtcagaataaatgagtctcaggatgacgatgccttttatcttgct
actaataaggctgctcacgaagcagatccaacacgtcctactggaggtgtcagggcaata
gctcatagccacttattagaggatgtctatacctataacgattttatacatgatggcgta
aaaagaggctgtcagccaaagcaaaaggttacatccaataaccataaaccttatcttatt
accgaatattgtggacatatgtatcctactaaaacctatgatgatgaggcacacaaaagg
gaacatgccagacgtcacgccaatattcttgatgcagttgcctcagaaaatgaaatagca
ggttcctttggctggtgtatgtttgattataatactcaccgtgacttcggtagtggagat
agaatatgttatcacggtgttatggatatgttccgcaatccaaagcctgctgcttatgta
tatgctgctcttggtaatagaaatcctgtactagagatcagttcctccatggatataggc
gaacatcctggctgtataagaggggatatttatatctacaccaatgcagattcagtaagg
ttttataaaaataatgaattgattaaggaattttttaatagagacagtacatatagtcac
ttatcccatggacctattactatgaatgattttataggtgataagatgggcaaacaagaa
cacttttcatcaagacaggaagctctagtaaaagacctaattaacgcttatgccttaaaa
ggagcagattgtatgacgctgggacttatgcttaaagctctagcacttatggccatatac
cgcatgaaaccagcagatgccttgaggctgtataatcaatacatcggagattggggtggc
acagctactacctataggtttgatgccatcacaaatggcaaggtcgttaaatctatcacc
aaagccccaatgactagcatccatttaaaagggactaccaatactcaaatgctgacggaa
agcgatacctatgatgtagcctctataaggctttctgctacagatgaatacggtaatgtt
cttccctattattcaggctacgcacacatcacctgtgaaggagctatcgcattaatcgga
ccagacatcctaccttttcaaggggggtacagcggatgctacgttaagaccatcggttct
gagggacagggaagtgtcaccgtttctattccagagacagatccagtcacctttacattt
catgtgacttgtaaaaataatgccaatcagaatggaggattataa

DBGET integrated database retrieval system