KEGG   Cellulosilyticum lentocellum: Clole_3541Help
Entry
Clole_3541        CDS       T01448                                 

Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
cle  Cellulosilyticum lentocellum
Pathway
cle03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cle00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Clole_3541
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cle03011]
    Clole_3541
Ribosome [BR:cle03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Clole_3541
  Bacteria
    Clole_3541
  Archaea
    Clole_3541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ADZ85225
UniProt: F2JT06
Position
complement(3857900..3858286)
Genome map
AA seq 128 aa AA seqDB search
MAKGHRSQIKKERNAQKDSRPKARVTFVRLSSTKANIVLDQIKGKDVNTALAILAYTPRW
GARVVEKVLKSAIANAEHNMGMDASTLYVDEAFSTKGPTLKRIRPRAQGRAYQIQKQTSH
ITVVLNAR
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggacatagaagccagatcaaaaaagagagaaacgctcaaaaagactcaaga
ccaaaagctagagtaacattcgtacgtttatcaagtacaaaagcaaatatcgtgcttgac
caaattaaaggaaaagatgttaatacagcattagctatcttagcatacacaccaagatgg
ggtgctcgtgtagtagagaaagtattaaaatctgcaattgcaaacgctgaacacaatatg
ggtatggacgcttcaacattatatgtggatgaagcattctcaacaaaaggaccaactctt
aaaagaattcgtccacgtgctcaaggtcgtgcatatcaaattcaaaaacaaactagccac
attacagtggtattaaatgcgagataa

DBGET integrated database retrieval system