KEGG   Cimex lectularius (bed bug): 106661153Help
Entry
106661153         CDS       T05603                                 

Definition
(RefSeq) non-lysosomal glucosylceramidase isoform X1
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
clec  Cimex lectularius (bed bug)
Pathway
clec00511  Other glycan degradation
clec00600  Sphingolipid metabolism
clec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clec00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    106661153
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    106661153
Enzymes [BR:clec01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     106661153
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N DUF5127
Motif
Other DBs
NCBI-GeneID: 106661153
NCBI-ProteinID: XP_014239866
Position
Unknown
AA seq 810 aa AA seqDB search
MDGVAKYGWKARLDYQFPQKRSQNLTPTIKQMISMIPMSIRYTIYYIWKWLHFEKPVMDF
FNVVHCQNKSGVPLGGIGCGTIGRGFRGDFCGYQMKPGIYEYYTSHATQFIVNIQDENGK
TLYQKVLSCSSKPDGYVLNQWDWSFPPSDAEYTALYPQSWTVFDIKEQNIKLICRQVSPV
IPHNYKDSSLPVAVFEWRVINNNKSHRFVSITFTFKNGTGSPSDKTEPAWSESFDKKDEL
GAASGVTIRQSFGDLPCSYSVASSINTNTAVTRSLYFKANGNGSTIWNALKKNGDLKSEP
DQKTLSIDTGTELGCAVCSRINVSGYSEGTLSFSLSWDMPKIHFPGGNIWKTRYYTKYFG
DIGHAGPEICFHSLKNYKQWIAQINSWQEDILNNKTTPDWFKSALLNELYYVSNGGTVWL
LLDDEEKKKLSANDPRLEFGRFGYLEGHEYIMYNTYDVHFYASFALAMLWPKLQLALQYD
FNDAIAIEDKTQVWFLYNGICGQRKVKDTVPHDLGSAGNQAFSIINYYPIHDVSKWKDLN
LKFVLQVYRDYTLMKDKSYLVDMFPNVIRVMEYSLQWDTDNDGLIENSGFPDQTYDTWIM
RGTSSYCGSLWLAALVVLVEMAKILGDKDVEEKFNKILLKGKVSFDKKLFNGSYYIYDSS
NGEHSKSIMADQLCGLWYLHCCGLKNNIFVETHVKSSLKVVFENNVSNYYNGEQGAVNGM
LPDGSVDTSSTQSGEVWTGVSYALACLLIQEGFYEEGFKTASGIYNTVYNKSGLGFSTPE
ALFKETCYRSVGYMRPLSIWSIQLALQKVI
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atggatggtgtggcaaaatacgggtggaaagcccggctggattatcaattcccacagaag
agatcacaaaacttgacacctaccataaaacagatgatatcaatgattcccatgtcaata
aggtatacaatatattacatatggaaatggttacattttgagaaaccagtaatggatttt
tttaatgttgttcactgtcaaaacaaaagtggagtgcctctgggcgggattggatgtggg
actatcgggagagggttcagaggagatttttgcggctatcagatgaaacctgggatttac
gaatattacacttctcacgctacgcagttcatcgtaaacatccaagatgagaatggtaaa
actttataccaaaaagtattatcttgttcgagcaaacccgatggttacgttttaaatcag
tgggattggagttttccaccttctgatgccgaatacaccgccctttacccacaatcatgg
actgtttttgatatcaaagaacaaaatataaaattgatctgtcgacaagttagccctgta
atcccacataattacaaggattcatctttacctgtggcagttttcgaatggagggtcatt
aataacaataaatcacacagatttgttagcattacatttactttcaaaaatggaactggt
agtcccagtgataagacagaacctgcttggagtgaaagttttgacaaaaaagatgaatta
ggagcagcaagtggagtaacaattagacaatcgtttggtgatctaccttgttcttattca
gtcgcaagttcaataaatacaaacactgctgtcacaagaagtttgtatttcaaagctaat
ggaaacggttcaaccatatggaatgcattaaaaaaaaatggcgatttaaaaagtgagcca
gatcagaaaactttatctatagacactggaacagaacttggttgtgctgtctgcagtagg
attaacgtcagcgggtacagtgaagggacattgtctttttcattaagctgggacatgcct
aaaatacatttcccaggaggtaatatttggaagactagatactatacaaaatattttggc
gatataggacatgctgggcctgagatctgtttccattccctaaagaattataaacaatgg
atagctcaaatcaattcctggcaagaggatattctaaacaacaaaactaccccagactgg
tttaaaagtgctttgttgaatgagctctattatgtatccaatggaggcacggtatggtta
ttacttgatgatgaagaaaaaaagaaactttctgctaatgacccaaggctagagtttggg
agatttggttatttggaaggtcatgaatatattatgtacaacacatacgatgttcacttc
tatgcatcatttgcattggccatgctctggcctaaattgcaacttgctttacagtatgat
tttaacgatgcaattgccattgaggataaaacccaagtttggttcttgtacaatggaatt
tgtggacagcgaaaggtaaaagatactgttccccatgatttaggaagtgcaggcaaccaa
gccttttctattataaattactacccaatacatgatgtttcaaaatggaaagacttaaac
ctcaagtttgtacttcaagtttatcgcgactatacattaatgaaagataaaagttatttg
gtggatatgttcccgaatgtcatacgagttatggagtactctttgcaatgggatactgac
aatgatggtctcatcgagaattctggatttcctgaccaaacatatgacacttggattatg
agaggaactagctcttattgtggcagtttgtggcttgcagcacttgttgtattggtggaa
atggccaaaatattgggtgacaaggatgttgaagagaaatttaacaaaattttgctcaaa
gggaaagtgtcttttgataaaaagctgtttaacgggtcttattatatttatgacagttca
aatggggaacattctaagagcattatggcagatcaactgtgtggtctgtggtatctccac
tgttgcggattaaaaaataatatatttgtcgaaacacatgtcaaatcttcgctgaaggtt
gtgtttgaaaataatgtttcgaattattataacggtgagcaaggagcagtgaatggtatg
ctacctgatggttcagtagacacgtcttcgactcagagtggagaggtttggacaggggtt
tcttacgctcttgcttgtcttctcatacaagaggggttttatgaggaaggttttaaaaca
gcttctggaatatacaacacagtgtacaacaaatcaggattaggattctcaactcccgaa
gcgttatttaaagaaacatgttacagatctgtgggatatatgcgaccgcttagtatctgg
tcaattcaattggctttacaaaaggttatttaa

DBGET integrated database retrieval system