KEGG   Cimex lectularius (bed bug): 106661764Help
Entry
106661764         CDS       T05603                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform isoform X1
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
clec  Cimex lectularius (bed bug)
Pathway
clec00071  Fatty acid degradation
clec01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:clec00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    106661764
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:clec03029]
    106661764
Enzymes [BR:clec01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     106661764
Mitochondrial biogenesis [BR:clec03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    106661764
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 106661764
NCBI-ProteinID: XP_014240868
Position
Unknown
AA seq 771 aa AA seqDB search
MAEAHSAVAFSFSITHEGWDVNFDREVLHLVWASGVRSWKKRLARFKNNLKSGLFPSPVN
SLWATVAVMTGCHFAGVKIPYIEELLLYMPEKSTKNQIMACCGFSVACWLGVTYSLRYAL
KLLFMYKGWMYEERGPGSKISLKTRLWVMAVKTLTGPSKPMLYSFQGSLPRLPLPSVPET
MCRYLRSVRPLLNDEQYIRMEKLAKEFQNGIGKKLQRYLALKSWWSSNYVSDWWEEYVYL
RGRSPLVVNSNFYGIDTLLMFHTNNQAARAATVIHTILQYRRLIERQELEPILLQGIVPL
CSWQYERVFNTTREPGVETDKIVHYSDSKHIVVYHKGRYFKVLIYYKNRILLPCEIEIQI
NMILEDKSEPVEGEEKLAALTAGERTHWANTRQEHFFKGTNRHSLDAIEKSAFVVALDDI
PYEFDEKEPHKLDIYGRNLLHGKGYDRWFDKSFTLCVGNNGRIGFNSEHSWADAAIMSHL
WEFAVSDEAGQEWYGPDGRTLGVPEFKPPAPIRLHWDFKPGCLNAIDSANQVVQKIISDV
DLRIYMHTNYGKGFMKTCRLSPDAYIQMALQLAYYRNAGKFSLTYEASMTRLYREGRTET
VRPCTVESSAWVKAMEDKSKTTQEKVALLQKACKQHQLAYQDAMCGKGIDRHLFCLYVVS
KYLEVDSPFLKEVLSEPWRLSTSQTPHGQTSKLDLKKFPRCISAGGGFGPVADDGYGVSY
IVAGEDILFFHISSKKSCPETDSSKFALDIEQALKDIQTLFVQYKKETQKK
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcccattcggccgttgccttttccttttcgatcacccacgaaggatgggac
gtcaacttcgaccgggaagttcttcacctggtctgggcgtccggtgtaaggtcttggaag
aagcgtttagcgaggttcaagaataacttaaaaagtggactgtttccatctcctgttaac
agtctatgggcgactgttgctgttatgacaggatgccattttgcaggagttaaaatccct
tatatagaagagcttctgttatatatgccagaaaagtcaacaaagaatcaaataatggcg
tgctgcggattttcagttgcgtgttggttgggcgtgacatattctttaagatatgcattg
aagttgcttttcatgtacaaaggttggatgtatgaagaaagaggacctggaagcaaaata
tcactgaaaacccgtctttgggttatggctgtgaaaacactgacaggcccaagtaaaccg
atgttgtacagttttcagggctcacttcccagattgccacttcccagtgtacctgaaacg
atgtgtcgttatttaagaagtgtccgtcctctactaaatgatgaacaatacattcgtatg
gaaaagttagctaaagaatttcaaaatggaatcggcaagaaattgcaaagatacctcgct
ctaaaatcatggtggtctagcaactatgtgtctgattggtgggaggagtacgtttatctc
cgtggtagatctcctttagtcgttaattcaaatttctacggaatagatacattactcatg
tttcacacaaacaaccaggcagccagagctgctactgtcattcatacgatactccagtac
aggagattaatagaaagacaggaattagaacctatattacttcaagggatagttccattg
tgttcatggcaatacgaaagagtattcaatacaacaagggaaccaggagtggaaacagat
aaaattgttcactactccgattcaaagcatattgtcgtttatcacaaagggagatatttt
aaggtcctaatttactacaaaaatagaattcttttgccttgtgaaattgaaattcagata
aatatgattttggaggacaaatctgaacctgttgaaggagaagaaaagcttgctgctctc
actgcaggtgagaggacgcattgggccaatacgaggcaggagcactttttcaaaggcacc
aatcgacacagtcttgatgctattgagaaatctgcttttgtcgttgccttggatgacatt
ccttatgaatttgatgagaaggaaccacacaaattagacatctatggaagaaatttactt
catggaaagggttatgacagatggtttgacaaatctttcaccttgtgtgttggaaacaat
ggaaggattggcttcaattctgagcattcttgggcggatgcagccataatgtcacacctt
tgggagttcgctgtttcagatgaagcaggacaagaatggtacggtccggacggacgcact
cttggagtgcctgagttcaaacctcctgcgccaatcaggttgcattgggatttcaagcct
ggctgtctcaatgctattgacagcgcaaatcaagtggtccaaaaaattattagtgatgtt
gacttaagaatctacatgcacacaaattatggcaaaggttttatgaagacttgtcgtctt
agcccggatgcttatatccaaatggcactccagcttgcatattatagaaatgctggaaaa
ttcagcttgacatatgaagcatcaatgacacgactttatcgagaaggacggactgaaact
gtacgcccctgtacagttgaatcttctgcatgggttaaagccatggaagataaatcgaaa
acgacgcaagaaaaagtagcccttctgcagaaagcttgcaaacaacatcaactcgcatac
caagatgcgatgtgtggaaaaggaattgacagacacctcttttgcctctatgtggtttcg
aaatatttagaagttgattctccattcttaaaagaggtgctaagtgaaccatggaggctt
tctacatcacaaacgccacacggccaaacatcaaaattagacctgaaaaaatttccaagg
tgtatttctgcaggtggtggttttggacctgtggccgatgacggctacggtgtatcatat
atagtcgctggagaagatattttattttttcacatttctagcaagaaaagttgcccagag
actgactcgagcaagtttgctttagacatcgaacaggctttgaaagacattcaaacattg
tttgtacaatataaaaaggagactcaaaagaaatag

DBGET integrated database retrieval system