KEGG   Cimex lectularius (bed bug): 106662760Help
Entry
106662760         CDS       T05603                                 

Definition
(RefSeq) biotin--protein ligase isoform X1
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
clec  Cimex lectularius (bed bug)
Pathway
clec00780  Biotin metabolism
clec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clec00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    106662760
Enzymes [BR:clec01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     106662760
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     106662760
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     106662760
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     106662760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BPL_LplA_LipB BPL_C Na_Pi_cotrans
Motif
Other DBs
NCBI-GeneID: 106662760
NCBI-ProteinID: XP_014242532
Position
Unknown
AA seq 948 aa AA seqDB search
MLTVYYIAATWLQSRRLNTILHKVSTVHRKQGTVVVHQELPPYLSYNGGVQRKLIVTSVL
SDYCQNYRNGQIADLMLYASSKRMVSIYPKVKQVLDISGWVEVLPGRTHLPIQLNEFRHN
FPSDDKIQVLLEANYNTCQFNYSSKVLQVEDLGNPIAWFVGDRICILLEMNDDKLAYLTL
VFMQQNITLENGIEIMRIESVKTTGTPYKIENTKCIPETYAQLDTSMTKEELKDSFMGRW
RAHISMLCTFCDAISQVKSMHQDISVRHPGSGVGAVKLVPGSPKCKSLSPKQSIQEEISN
GECSSITSNTCTVESPTLSVSNPSTEMSTAQGSTRLAADSTATSMSSLRSFPATPKKTQE
KENGTVVKPPNIIILSDSPSSAEAVKLALENCLIRDRYTIYIVNFSDEGVLSLEHACLVV
IHGNIPSNFTSHVMKYLLEYSGSLLCLCSDFIGSILPMFATAEVRPNELVRCSYKTWKHV
PLMHHVFCYQPTPRKPQFTHDEHSSLRAIPESVQITDSHEKVHLLKVDILGAEETWQTPS
LLLVSLVNSTSKIVFSQVHLEIDPGQYEVDDKKRQALEKSDKARIEIFSDVLGNHLGLKC
SSNQKNINYTHGYFLGNHEVKQQFLNKLKANDKLDENCVLKHNDLTIKFCGKGINPGPAT
SNQLPVLLHSCPESFSTVDYFDNLKTSFLGRLAIFSEVMTSSMDLLDGIEMVHGFTTIPM
YQTKGKGRSGNTWLSPKGCAMFSIQLHIPLDSNLGKHLSLLQHISSLAIVSSICELPHLK
DLNIHLKWPNDIYANKTTKIGGVMATSMLSSTKAICNVGCGVNLQNTEPTLSINDLISNM
SNDKKINIKGLTFEHYFACVFNKLEELIDSINTDGIEVFFPQYYTYWLHSDAVVSVHLPQ
KTKKNVRIKGIDSYGYLTVETSEGEVLTVQPDSNSFDMMAGLIVPKII
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atgttaacagtgtattacattgcggcaacatggctgcagtcaaggagattgaacacgata
ctgcacaaagttagtaccgtccacagaaagcaaggtactgtcgtcgtccatcaagagctg
ccaccttatttgtcgtataacggaggcgttcaacgcaaattaatcgtaaccagtgttctc
tctgattactgccagaattacaggaatggacagattgccgatttgatgctgtacgcttca
agtaaaagaatggtttctatctatccaaaggtaaagcaagttttagacatatcaggttgg
gtagaagttttgcctggaaggacacatttaccaattcaactaaatgagttcaggcacaat
tttccatctgacgacaagatccaagtgcttctcgaagcgaattacaacacctgccaattt
aactattcctcaaaggttttacaggttgaagatctcggtaatcccatcgcttggtttgtt
ggcgacaggatatgtattttgctcgaaatgaacgatgacaaattggcttacctcacattg
gtattcatgcagcaaaacatcacccttgaaaatggaatcgaaataatgagaatagaaagt
gtaaaaactacagggacaccttacaaaatagaaaacactaaatgtatcccagagacatac
gcacaacttgacacctctatgacaaaggaagaactgaaagacagttttatgggccgctgg
agagctcatatttctatgctttgcacgttttgcgatgccatatctcaagttaaaagcatg
catcaggatatctctgtaagacacccgggctctggagttggggctgtaaaactggtacca
ggaagtccaaagtgcaaaagtttatcaccaaaacaatctattcaagaggaaatctcaaat
ggtgaatgttcgtcaataacatcgaatacgtgtacagttgaaagtcccactttaagtgtt
tcaaatccaagtactgagatgtccacagcccaaggttccactcggttagctgcagattca
actgcgacttcaatgtcttcactgcgatcttttcctgcaacacctaaaaagactcaagaa
aaggagaatggcacggtggtcaaacctcccaatattataatactttccgacagtccgtct
tcagctgaggctgtcaaattagctttagaaaactgtttaatccgtgacaggtatacaatt
tatatagtgaatttttcggatgaaggggttttgtcattagaacatgcctgtctagttgtc
attcatggaaatatcccttctaattttacatctcatgttatgaaatacctcctggaatat
tctgggtctttgctgtgtctttgctcagattttattggctcgatactcccaatgtttgcc
actgccgaagtgagaccaaacgagcttgttagatgttcctataagacatggaagcacgtc
cctttaatgcaccatgtcttctgttatcagccaacaccgagaaagccacagttcacacac
gatgaacactcaagtctgagagcaattcctgaatctgttcaaatcactgatagccatgag
aaagtacacttgcttaaagttgatattctcggtgctgaagaaacgtggcaaactcccagc
ttacttctcgtttctttagtaaactctacttcaaaaattgttttttcccaagttcattta
gaaatagacccaggacaatacgaagtggacgacaaaaagaggcaggctttggaaaaaagt
gataaggcaagaattgaaatttttagtgacgtccttggaaatcatttaggcctaaagtgt
tcatcaaaccagaaaaacataaattacacacatggctatttcttaggaaaccatgaggtg
aaacaacaattcttaaataaattaaaggccaatgataaattagatgagaattgtgtttta
aaacataatgacttaactattaagttttgtgggaagggaatcaatcctggaccagctact
tctaatcagcttccagttcttctccactcctgccctgaatctttttcaactgttgattat
tttgataatttgaaaacgagttttcttggaaggttagcaatattctctgaagttatgact
tcatctatggatcttttagacggcattgagatggttcatggcttcacgacaattcctatg
taccagacaaaagggaaaggaagaagcggtaacacttggttgagtccaaaaggatgcgct
atgttttccatccaattgcatatacctttggattccaatttgggaaaacatttgtcactt
ttacaacatatttcaagtcttgcgattgtatctagtatatgtgaattgcctcacttaaag
gatctaaatatccatttaaaatggccaaatgacatttatgctaataaaactaccaaaatt
ggcggggtgatggctacatcaatgttgtctagcaccaaagcaatttgcaatgttggttgc
ggggtcaacttacaaaacacagagccgacactgagtattaacgatttgatatcgaacatg
agtaatgacaaaaagataaacattaaaggattgacgtttgagcattattttgcttgtgtt
tttaataaattggaagagttgattgactcaattaatactgatgggattgaagtatttttc
ccccaatactacacttattggcttcacagtgatgcagtagtgagtgtccatctacctcaa
aaaacaaaaaagaatgttagaatcaaagggatagattcttatgggtacttaactgtcgaa
accagtgaaggtgaagtactgacggtgcagcctgatagtaattctttcgatatgatggct
gggctgattgtgcctaaaattatatga

DBGET integrated database retrieval system