KEGG   Cimex lectularius (bed bug): 106663330Help
Entry
106663330         CDS       T05603                                 

Definition
(RefSeq) myotubularin-related protein 8 isoform X1
  KO
K18083  myotubularin-related protein 6/7/8 [EC:3.1.3.64 3.1.3.95]
Organism
clec  Cimex lectularius (bed bug)
Pathway
clec00562  Inositol phosphate metabolism
clec01100  Metabolic pathways
clec04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:clec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    106663330
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    106663330
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:clec01009]
    106663330
Enzymes [BR:clec01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     106663330
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     106663330
Protein phosphatases and associated proteins [BR:clec01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    106663330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related FYVE DSPc GRAM Y_phosphatase ArfGap ABC_tran_CTD Y_phosphatase3 zf-B_box
Motif
Other DBs
NCBI-GeneID: 106663330
NCBI-ProteinID: XP_014243575
Position
Unknown
AA seq 724 aa AA seqDB search
MNILNSFMPYPGFHQTTTHEETLTFLRVETLGTVVAMISCSLFQARRKLIIVNASFYGCI
ENVRMLDRYNARKLCFGNLFVTATHLIFVETETNKETWILLLHIASVEKLPISTSGCPLQ
IRCKTFHSVTFVIPRERACHDVYSSLLKLSQLEKVEDLFCFRSSNCENIPKTAGWNFFDL
QAEFQRMRVPNEQWSLTLLNKDYELCDTYPSLLFVPSTANTTILTGSSKFRSKGRLPVLT
YLHKNKAAICRCSQPLSGFNARCLEDEQMLNCIIATNPTAPHMVVVDTRPLINAMANRAK
GKGGYENENFYDNIKFSFMGIENIHVMRNGLMKLIETCELKWPSMSGFLSGLESSGWLKH
IKSILDTSWFIAQAVESGVNVLVHCSDGWDRTAQVCSLAAMLLDPFYRTIQGFQALIEKD
WLSFGHKFTDRIGHLAGETKEVSPVFTQFIECTWQLMEDFPTAFQFNESFLFAIHDNTSS
CLYGTFIGNCEKERIELRLSERTFSLWGFMANHMREYINPLYNPKFCEGVLRPNLIPQNI
RFWRGMYCRFESGVHPRESVSESLLVASNHSNSLEEHIKLLQKKINALTKLLSDPQGKKM
YEKINSASCTGNKVNEQEDVLKNAVPLVKSNPFDLNKKSIDSLSDDLTALALDWKTLRNV
KCFECTAPSDHSMVKYHCWQCGNIFCTRCIEKHITLPGHLSQCAVPVCHPCYQKLNRSSS
AETP
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgaatatactcaattctttcatgccataccctggattccaccaaacgacaactcatgaa
gaaacattgacatttcttcgcgttgagacgctgggcactgttgtagccatgatatcgtgt
tcgttattccaggctagaagaaagctgataatagtaaatgcttcattttatggttgtatt
gaaaatgttcgtatgttggatcgttacaacgcaagaaagctctgttttggaaacttgttt
gtaactgcaactcatcttatatttgttgaaactgagactaataaagagacatggatttta
ctgctccatattgcatcggtagagaaactgccaatttcaacatcaggatgtcctttgcag
atcagatgtaaaacttttcattcggtcacatttgtcattccacgtgaaagggcttgccat
gatgtatacagttctcttttaaaattgtctcaacttgaaaaagtggaagaccttttttgt
tttcgctcttccaattgtgaaaacattcctaaaaccgctggatggaattttttcgatctt
caagcggaatttcaaagaatgagagtcccaaacgagcagtggagcctcaccctcctcaac
aaagattatgagctctgcgacacatatcctagtttactttttgttccgtctacggcaaat
actaccattttaactggcagttccaagttcaggagtaaaggacgactacctgttttaact
tacctacataaaaataaggctgcaatatgtagatgcagtcagccgttatctggatttaat
gcaaggtgtttagaagatgaacaaatgttaaattgtatcattgctactaatccaactgca
cctcatatggttgttgtagatacaaggccattgataaacgcaatggcaaatagagcgaaa
ggaaaaggaggatatgaaaatgaaaatttttatgataatataaaattcagctttatgggt
attgagaacattcatgtgatgagaaatggactcatgaaactaattgaaacttgtgaactc
aaatggccctccatgtcaggatttttaagcggattagaaagcagcggttggttaaagcat
ataaaatctattctcgacacgagttggtttattgctcaggccgtagagtccggggttaac
gttttagtgcactgcagcgacggttgggacagaactgcgcaagtgtgctcacttgctgcc
atgcttttggacccgttttatagaacaatacaaggcttccaggccctaattgaaaaagac
tggcttagttttggccataagttcacagatcgaatcggccatttggccggcgagaccaaa
gaagtctctccagtatttacacagtttatcgaatgtacgtggcaattgatggaagatttt
ccaacggctttccagtttaatgaaagctttttatttgcgatccatgataatacgagttct
tgtttatatggaacattcataggaaattgtgaaaaagaaagaatagaacttagattaagt
gaaaggactttctcattatggggcttcatggcaaatcatatgcgagaatatataaatcca
ctgtataatccgaaattttgcgaaggagttctaagaccaaacctcataccccagaatata
aggttttggagaggaatgtactgtcgttttgaaagtggcgtccatcccagagagagtgtg
agtgaatccctgctagttgcttccaatcatagcaattcattagaagaacatatcaaacta
ctacaaaaaaaaattaatgcactcacaaaactattgagtgatcctcaaggcaaaaagatg
tatgaaaaaataaattcagcatcatgcactggcaataaggtaaatgagcaggaagacgtt
ttgaagaatgctgttccattagttaaaagtaatccttttgatctaaacaagaaatcaatc
gattcattaagcgatgatttaactgcgctcgcattagattggaaaacactcagaaacgtc
aagtgctttgaatgtacagctccttctgaccatagtatggtaaagtatcactgttggcag
tgtgggaatatattttgtactcgctgtatcgaaaagcatataactcttcctggccacttg
agccagtgtgcagttcctgtctgtcatccatgttaccaaaaattgaatcgctcatcatca
gctgaaactccgtga

DBGET integrated database retrieval system