KEGG   Cimex lectularius (bed bug): 106665130Help
Entry
106665130         CDS       T05603                                 

Definition
(RefSeq) methyltransferase-like protein 14 homolog
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
clec  Cimex lectularius (bed bug)
Brite
KEGG Orthology (KO) [BR:clec00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:clec03019]
    106665130
Enzymes [BR:clec01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     106665130
Messenger RNA biogenesis [BR:clec03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     106665130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70
Motif
Other DBs
NCBI-GeneID: 106665130
NCBI-ProteinID: XP_014246832
Position
Unknown
AA seq 386 aa AA seqDB search
MSSTLKELKERSQRRKLLLAQTFGVSNAAELRQALGTSVEEPPKKKVKAAPTPIDQAKEK
EEESDGVVYKDSSTFLKGTQSSNPHNDYCQHFVDTGQRPQNFIRDVGLADRFEEYPKLRE
LIKLKDDLIAQTATPPMFLKCDLETFSMKDLNVKFDVILVEPPLEEYQRTMGVTNTKLWS
WEQVMELDIGEVAASRSFVFLWCGSSEGLDMGRACLRKWGFRRCEDISWIRTNINNPGHS
KNLEPKAIFQRTKEHCLMGIKGTVRRSTDGDYIHANVDIDLIISEEPEYGSLEKPVEIFH
IIEHFCLGRRRLHIFGRDSTIRPGWLTLGPDLTNSNFNWEVYSSYFTLSTLTTGCTERIE
ALRPKSPPPKLGKQRANYPRTRPRQR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcacgctcaaggagctgaaagagcggtcgcaacggaggaagctgctcctcgcc
cagaccttcggggtttcaaacgctgccgagttaaggcaggctctcgggacgtctgtggaa
gaaccgccaaagaagaaagtcaaagcagcgcctacgccaattgaccaagctaaggagaag
gaagaagagagcgatggtgttgtttacaaagactcttcaaccttcctcaaaggaacacaa
tcgtcaaaccctcataatgactattgccaacacttcgtcgacactgggcaacgccctcaa
aacttcatcagggatgtcggcctcgctgataggttcgaggaatatcccaagctaagggaa
ttaataaaattaaaggatgatctcatcgctcaaactgcaacgcctccaatgtttttaaaa
tgcgaccttgaaacgtttagcatgaaagacttgaatgtgaaatttgacgtgatactcgta
gaacctcctttggaagaataccagaggacgatgggcgtcacaaatacaaaactctggagc
tgggaacaggttatggaattggatataggagaagtagcggcatctaggtcatttgttttt
ctttggtgtggttcatcagaaggtttagacatgggcagggcctgtctccgaaagtggggt
ttccgacgatgtgaggatatctcatggattcggacaaacatcaacaacccaggtcatagt
aaaaacctggagcccaaggctatcttccaaagaaccaaggaacactgcttgatgggtatt
aaagggactgtgcgacgttcaacagatggtgactacatccatgcaaatgttgatatcgat
ttgatcataagtgaagaacctgagtatggctctttagaaaagcctgtagaaatctttcat
atcatcgaacacttctgtctcggcaggaggaggctgcacatttttggaagagacagcact
atccgaccgggttggctcacattaggcccagatttgacgaacagcaatttcaactgggag
gtttactcgagctactttaccctttcaacactcacgacgggctgtaccgagaggatcgaa
gcccttaggcctaagtccccacctccgaagctcggaaaacagagagccaattatccaaga
acgaggccaaggcaaagatag

DBGET integrated database retrieval system