KEGG   Cimex lectularius (bed bug): 106667151Help
Entry
106667151         CDS       T05603                                 

Definition
(RefSeq) cathepsin O-like
  KO
K01374  cathepsin O [EC:3.4.22.42]
Organism
clec  Cimex lectularius (bed bug)
Pathway
clec04142  Lysosome
Brite
KEGG Orthology (KO) [BR:clec00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    106667151
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:clec01002]
    106667151
Enzymes [BR:clec01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.42  cathepsin O
     106667151
Peptidases and inhibitors [BR:clec01002]
 Cysteine peptidases
  Family C1: papain family
   106667151
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Peptidase_C1_2 Inhibitor_I29
Motif
Other DBs
NCBI-GeneID: 106667151
NCBI-ProteinID: XP_014250363
Position
Unknown
AA seq 354 aa AA seqDB search
MEKWKFWFSILVFAGLCFLALRFTLTVRNEESEEHLFASFLKKYRRNYTEESEEYKSRLD
AFKNAVKLTKEWNNGRTSELSALYGITQFADILSKDFSKKYLRGRSHAKIHKHTHYHHHH
HDNVTAQRIKRAIDVDLPNVVDWRNKNVVNSVKDQKLCGACWAFSTVGVIESIAAIKTGV
LPTLSVQQMIDCARNGNMGCVGGDPCSLVEWLDENNIKVVSELDYPLLLKDNACIVKKSD
YGIRIADYTCDYLVGKEEKLLKMLALHGPVAAAVNALSWQFYLGGVIESHCDGALDKLNH
AVQIVGYDLTSSLPHYIVKNSWGKYFGEKGYVRVAIGANVCGIASEITSLDVIT
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggagaaatggaagttttggttttcgatcctcgtattcgccgggctctgctttctcgcc
cttagattcacactgaccgtgagaaacgaggagagtgaggagcatctcttcgcctccttc
ttgaaaaagtacagaagaaattacacagaagagagcgaggaatacaaatcgaggctggac
gcttttaagaatgctgttaaacttacaaaagaatggaacaatggcagaacatcagagtta
tcagctctctacgggataacacaatttgctgatattttgagcaaagacttttccaagaag
tatctcagggggcgcagccatgcgaaaatccataagcatacacattaccatcaccaccac
cacgataacgtcaccgctcaacgtatcaagagagccatcgacgtcgaccttccgaatgtc
gttgattggaggaataagaacgtggtgaactcggttaaagaccaaaagctctgcggagct
tgctgggctttcagcactgttggagttatcgagtccatagccgctatcaaaacaggcgtc
ttgccgacccttagcgtccaacaaatgatagattgtgcaagaaatggaaatatgggatgc
gtcggaggggatccatgctcattggttgaatggctcgacgaaaataatataaaagtggtg
tcggaattagattaccctcttttgttaaaggacaatgcctgtatagtcaaaaagtctgac
tatggaataagaatagcagactatacctgcgattacctggtaggaaaagaagagaaactg
ttgaaaatgttagccctccatggaccggtggctgctgccgtgaacgctctaagctggcag
ttttacctcggaggtgtaatcgagtctcattgcgatggcgcgttggataaacttaaccac
gctgttcaaatagttggctacgacctgacatcctctttgccgcattacatcgtgaaaaat
tcctggggcaagtatttcggtgaaaagggctacgtgagagttgcaatcggagccaatgtt
tgtggtatcgcatctgaaataacatcattggatgttatcacgtaa

DBGET integrated database retrieval system