KEGG   Cimex lectularius (bed bug): 106667581Help
Entry
106667581         CDS       T05603                                 

Definition
(RefSeq) sphingosine-1-phosphate lyase isoform X1
  KO
K01634  sphinganine-1-phosphate aldolase [EC:4.1.2.27]
Organism
clec  Cimex lectularius (bed bug)
Pathway
clec00600  Sphingolipid metabolism
clec01100  Metabolic pathways
Module
clec_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:clec00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    106667581
Enzymes [BR:clec01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.27  sphinganine-1-phosphate aldolase
     106667581
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP SepSecS
Motif
Other DBs
NCBI-GeneID: 106667581
NCBI-ProteinID: XP_014251102
Position
Unknown
AA seq 562 aa AA seqDB search
MVEPELLIVIFALAMKFQVSLGPRAIKECINTRFAGREPWQVAAITATSVLAGVWVWNIV
FQPESIVSRGKKFFFRMARKIPAVANKINKELSKISSDFEKDVKERMGHTNYNRVLQVKG
KSKEEIIEELKKNLDLGHYRWDKGFVSGAVYYFSPELINLLTEVYGLASYTNPLHADIFP
GVNKMESEVVSISTDLFHGSSKACGTMTSGGTESIIMACKAFRDYGREERGITNPEMILP
RTAHPAFEKAAFYFGIRICYIPVDPLTTSVIIKKVKQAINSNTIMIVGSVPNYPYGTMDD
IEALASLGRRYGVPVHVDCCLGGFLTAFMPQAGFELPPFDFSVPGVTSISADTHKYGFAP
KGSSVVLYSKPEYRHYQYCVTTDWPGGVYGSPTINGSRAGGIIAACWATLMYFGLEGYVK
STRKIIETTKYIERELRMIPEIFIFGKPITSVIAIGSEVFHIYRLSEILNDLGWNLNPLQ
FPPGVHLCVTHMHVAEGIADRFVQDVKNTVKIIMNDPKSEVKGKMAMYGKSQSIPDRSIV
SDFTKLYLDSTYYVPHEANSSN
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggtagaaccggagttgttgattgttatttttgctttagctatgaagttccaggtgagc
cttggccctagggcaatcaaggagtgcataaatacaagattcgcgggtcgtgaaccttgg
caggtggcagctatcacggcgacatccgttctcgccggagtctgggtctggaacatcgtc
ttccagcctgagagcattgtaagcagggggaagaagtttttcttcagaatggcccgcaag
atccctgcagtcgcaaacaaaataaacaaggaattgagtaagatctcatcggatttcgag
aaagacgtcaaggaaaggatggggcacacaaattacaacagggtgctccaagtcaagggc
aagtcgaaagaggagatcattgaagagctcaagaaaaacctcgatcttgggcattacaga
tgggataaaggttttgtatcaggtgcagtatattatttttcgcccgagctgatcaacctg
ttgaccgaggtatacggtctcgcatcgtacacaaaccccctgcatgctgacattttcccc
ggtgtgaacaaaatggaatccgaagtggtcagcataagcacggacctgtttcacgggagc
agtaaagcctgcggaacgatgacttcgggaggtacggagtcgataatcatggcctgcaag
gcgttcagagactatggaagggaagaacgcggtataacaaatccagaaatgatcttgccc
cgtactgcgcatcctgcttttgaaaaggcggctttttattttggcattagaatctgctac
atacctgtagatccattgacaacaagcgttatcataaaaaaagtaaaacaagctatcaac
tctaatacaatcatgattgtagggtcagttccgaattatccatatggaactatggatgat
attgaagctttggcatccttaggccggaggtatggtgttcctgtacacgtcgattgctgt
ttaggtggttttttaacagcattcatgccgcaagctggttttgagctaccaccttttgac
ttttcagtacctggtgtaactagtatttctgcagatactcataagtatggttttgctcca
aaaggatcttccgttgttctatactccaaaccagagtatagacattatcaatattgcgtt
acaactgattggccaggaggtgtttatggttctccaaccattaacggctccagagctgga
ggtataatcgctgcatgttgggcgactttgatgtactttggtctggaagggtatgtcaag
tcgacaagaaagataatcgagaccacaaagtacattgaaagggaacttagaatgatccct
gagatattcatattcggtaagcctattacatcggtaatagcgatcggctcggaggttttc
cacatatatcgcctttcagagattctcaacgatttaggctggaatctgaaccctctccag
ttccccccaggggttcatctttgtgtgacgcacatgcatgtcgcagaaggcatcgcggac
cgttttgttcaagacgttaaaaacactgtcaaaatcatcatgaatgatccaaaatcagaa
gtcaaaggaaaaatggcaatgtatggcaaatctcagagcataccagacaggtcgatcgtc
agtgatttcacaaaactttaccttgattcaacctattatgtgccacatgaagcaaacagt
tctaattga

DBGET integrated database retrieval system