KEGG   Cimex lectularius (bed bug): 106668831Help
Entry
106668831         CDS       T05603                                 

Definition
(RefSeq) methionine--tRNA ligase, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
clec  Cimex lectularius (bed bug)
Pathway
clec00450  Selenocompound metabolism
clec00970  Aminoacyl-tRNA biosynthesis
clec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clec00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    106668831
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    106668831
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:clec01007]
    106668831
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:clec03016]
    106668831
Enzymes [BR:clec01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     106668831
Amino acid related enzymes [BR:clec01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   106668831
Transfer RNA biogenesis [BR:clec03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    106668831
 Prokaryotic type
   Other AARSs
    106668831
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1 tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 106668831
NCBI-ProteinID: XP_014253453
Position
Unknown
AA seq 536 aa AA seqDB search
MRTLLLLKKINLYVYPRRFKSDCFVTTPIYYVNASPHMGHLYSSLLADAYYRFQLLLGHK
EGVFSTGTDEHGIKVQQAAAASGLPLLEYCDKISAEYRNLFDEFAIGYNQFIRTSDQKHK
DTVQHYWKILDKKGYIRKGTYKGWYCDADEAFLTEAQVTHVKSNGENSVVSVDSGRPVHW
VEEANYEFDLPRVKDRVKTWINSGESIRPKKFQDLCNTWLKEGLMDQPLSVSRPKKRVHW
AIEVPGDSEQSIYVWLDALLNYLTVREHLWPPTCQILGKDILKFHGIYWPAFLAALELDM
PRSFLVHSHWTVEGEKMSKSKGNVINPRICAEKFGISGVRYFLLREGTPHSDSNYSETKI
FRVLNSELADTFGNLLSRSTGSAVNKKQVFPPFDRNNFDKYCKMQASELISLLEILQDEV
GEYYSELNFYKGIALVMKVLHTANCFVESMKPWELRKDPSCSAHLDCVLHLSLECLRICS
IALTPVIPMLTNKLLDKLSIPVEARTWPDMVPSWKKEFEGSSLAHEKLILYRRIQA
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgagaacattacttttactgaaaaaaataaatttatatgtttaccccagacgttttaaa
tcagactgtttcgtgacaactccgatttactatgtcaacgcttctccgcacatgggtcac
ctgtacagttcgttgttggcagatgcatactacagatttcaactcttgctcggtcacaaa
gaaggcgtattctcaacgggaactgatgaacatggaataaaggtccaacaggccgctgca
gcttcaggtctacctcttctcgagtactgtgataaaatatctgcggaatatagaaatcta
ttcgacgagtttgcaatcgggtacaatcaatttataaggacgtcggaccaaaagcacaaa
gatactgtccagcattactggaaaatccttgataaaaaagggtatataagaaaaggcact
tataaagggtggtattgtgatgctgatgaggcttttcttaccgaagctcaagtgactcat
gtaaagtcaaacggggaaaattcagttgtcagtgttgattccgggaggccagtgcattgg
gtcgaagaggcaaactatgaatttgaccttcctagggtcaaagacagagttaaaacttgg
atcaactcaggtgaatccatcaggccaaaaaagtttcaagatctctgtaacacctggctc
aaagaggggcttatggatcaaccactgtcagtctcgaggcctaagaaaagggtccattgg
gcaatcgaagtgcctggcgattctgaacaatccatttatgtgtggcttgatgctctttta
aattacttaacagttagggaacatctttggccccccacttgtcaaatattgggaaaggac
attctcaagttccatggaatttattggcctgcatttttagcggcacttgagttagacatg
ccgaggtcatttctcgtccattcacattggacagtagaaggggaaaagatgtccaaatca
aaaggaaatgtcattaatcccagaatttgtgcagaaaaatttggcatctccggtgtacga
tattttttactaagggaaggaacaccacattcagacagcaattacagtgaaacgaaaata
ttcagagtattgaattcagagttggcagacacatttggtaatcttttaagccgaagtaca
ggatcagctgtcaacaagaaacaagtttttccgccttttgatagaaacaattttgataaa
tactgcaaaatgcaagcttctgaactgatatctcttttggaaattttacaagatgaagtc
ggagaatattacagtgaattaaacttttacaaaggaatcgcattggtcatgaaagtcctt
cacactgcaaattgctttgtcgaatccatgaagccttgggagctacgcaaagacccatcg
tgcagtgcacacttggactgcgtcctacacctttctttggaatgtttgagaatttgcagt
atcgcgttaacgccggtgattccgatgttgacgaataaacttctggacaagctcagcatt
ccagtcgaagcccgcacttggccagacatggtgccgagctggaagaaagagttcgaagga
agtagcctagctcatgaaaaactcattctttatagaagaattcaggcataa

DBGET integrated database retrieval system