KEGG   Cimex lectularius (bed bug): 106669451Help
Entry
106669451         CDS       T05603                                 

Definition
(RefSeq) endoplasmic reticulum resident protein 44
  KO
K17264  endoplasmic reticulum resident protein 44
Organism
clec  Cimex lectularius (bed bug)
Brite
KEGG Orthology (KO) [BR:clec00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:clec04131]
    106669451
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:clec04147]
    106669451
Membrane trafficking [BR:clec04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    106669451
Exosome [BR:clec04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   106669451
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin_6 Thioredoxin Calsequestrin Thioredoxin_2 OST3_OST6 CENP-U
Motif
Other DBs
NCBI-GeneID: 106669451
NCBI-ProteinID: XP_024081117
Position
Unknown
AA seq 459 aa AA seqDB search
MLEHLSPTRKSERRHSAAVGRQYLPCDDLVSLIGISGIALVDYRRFLFASRDFRMNLPSP
PAWYRFTILVYFFVSFNCYNPINTGAVSLTQSMIDNTLATNELVFINFYADWCRFSNMLA
PIFDEAADKVTADFPGPGQVVMGKVDCDKEGALASRFHITKYPTLKIFRNGQPAKREYRG
KRSVEAFQEFVKQQLTDPIKEFKDLSELKTLDTKKRIIIGFFEKKDCPEYNTFRRVASNL
KDDCQFHVGFGETVRAMHPPGQPIIVFRPDVALSNEKDETYKGSLLNYDEVNIWVGERCI
PLVREITFENAEELTEEGLPFLILFHRVGTDEEVVKRFKDIVSSELVSEIPNITFLTADG
LKFAHPLHHLGKSQSDLPLIAIDSFRHMYLFPDINDMEKPGSLKSFIRDLYSGKLHREYH
YGPDPNSVKVDEAPTLPPESTFKKLGPSKNRYTLLRDEL
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaacatttgtcgccgactcgaaagtcggaacgacggcactcggcagcagtcgga
cgtcagtaccttccgtgtgatgatttggtcagcctcatcggcatttctggtatagcttta
gtagattatcgccggttcctattcgcaagtcgagactttaggatgaatttgccgtcgccg
ccggcctggtaccgcttcacgattctcgtctactttttcgtgtctttcaattgttacaat
ccgattaacaccggtgcggtctcgctgacccagtcgatgatagacaatacgctagcgaca
aatgagctagtttttattaacttttacgccgactggtgtcggttcagcaacatgctcgct
ccgatattcgatgaggctgctgacaaagtaactgcagatttccccggccctggacaagtc
gtgatggggaaagtggactgtgataaagaaggtgccctggcgtcgcggtttcatataaca
aagtacccgacgctaaagattttcagaaatggccaacctgcaaagagagagtacaggggc
aaacggtccgtcgaagcgtttcaagagtttgttaaacaacagttaacagacccgattaaa
gagtttaaagacttgtctgaactgaagacattagacacgaaaaagaggatcataataggg
ttttttgagaaaaaggactgtcctgagtataacaccttcagaagagtggcgtccaacttg
aaagacgattgccaatttcatgttgggtttggggaaactgttcgagcaatgcaccctcca
ggtcagccaatcatcgtttttcgcccagatgtagcgttatctaatgaaaaagatgaaacg
tataaaggatcacttcttaattatgatgaagttaacatttgggttggggaaagatgtata
ccgctcgttagagagataacatttgaaaatgccgaagagcttaccgaagaaggccttcca
ttcctcattcttttccaccgagtgggaaccgatgaagaagtcgtcaaacgattcaaggat
attgtttcttcagaattagtcagtgaaataccaaatatcacatttttaacggccgacgga
ttgaaattcgcccaccccctgcatcatctcggaaagtctcaaagcgaccttcctctaata
gctatagacagcttcaggcacatgtacttgtttcctgacatcaacgatatggaaaagcca
ggtagcttgaaatcgttcatccgggatctgtactccggtaaacttcacagagagtaccac
tacggacccgacccgaattccgtcaaggtggacgaagcgccgactcttccaccggagtct
acattcaagaaattggggccgtctaagaaccgatacacgctcctcagagacgagctgtaa

DBGET integrated database retrieval system