KEGG   Cimex lectularius (bed bug): 106669991Help
Entry
106669991         CDS       T05603                                 

Definition
(RefSeq) cysteine--tRNA ligase, cytoplasmic
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
clec  Cimex lectularius (bed bug)
Pathway
clec00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:clec00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    106669991
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:clec01007]
    106669991
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:clec03016]
    106669991
Enzymes [BR:clec01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     106669991
Amino acid related enzymes [BR:clec01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   106669991
Transfer RNA biogenesis [BR:clec03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    106669991
 Prokaryotic Type
    106669991
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g tRNA-synt_1 tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 106669991
NCBI-ProteinID: XP_014255431
Position
Unknown
AA seq 727 aa AA seqDB search
MTTKRKGYDWVVEESVNRPTLKLFNSFTKRKEVFKPKEGNKIIWYSCGPTVYDASHMGHA
RSYMSFDILRRVLKDYFKYDVLYVMNITDIDDKIIRRARRQYLFNKYLETAAAKGKKSEE
ILADACEALTIFRTKVEAAEDQAVKQMLINQTEKVNSVMPELEAAVKKNDDALLGPVLEN
FLRVSEDVMSEWLDHTLGHTVKDNSIFLSLPRYWEEEFHKDMEALNICVPDIVCRVTDYI
PEIIKYIEQIQNNGFAYESHNSVYFDVTAFDSNSTHHYAKLVPEAVGDLKLLEEGEGVLS
ESKEKKSPGDFALWKASKPGEPFWDSPWGKGRPGWHIECSVMASHICGDTLDIHTGGVDL
KFPHHDNEIAQAEAYYKKDLWVRYFLHSGHLKIEGQKMSKSLKNFITIKEALTKYTARQL
RLLFLLHSWRDQLDYSDSTMLMALNYEKTINEFFLRVKDFLNISKKTNFVDNFHKYTDND
VKMKEKFQRTKDAVHAAFCDSVDTRTVMETIKEFISYCHSYLDQKNVDISLIENIALYVT
DMLKIFGLIFVKSSIGFPVNVNASVDVEEVLTPYLRILGNFRDDVRNSAKCSKDIEVLKL
CDQLRDDVLPNVGVRLEDKTEGPCTIKLVDRTVLLEEQRIKREEAAAKMNKKKEKVNVKQ
NPEPVEPPQNMFRSMKDKYSAFTAEGMPTHDAEGKEISKGQMKKLTKLYQAQEKKYEKFV
ADSALKK
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaaaaaggaaaggctatgattgggttgtggaagagagtgtgaacaggcctact
ttgaaacttttcaacagtttcaccaagcgaaaagaagttttcaagccgaaggaaggaaac
aagatcatctggtacagctgtggcccaacggtctatgatgcttctcacatgggacatgct
agatcttacatgtcattcgacatactaaggcgagtgttgaaagattacttcaagtatgat
gttctgtatgtaatgaacatcacggatatcgatgacaaaatcataagaagagctcggagg
caatatctcttcaacaagtatcttgaaactgccgcagcgaaggggaaaaagagcgaggaa
attttggcagacgcttgtgaagctcttacaattttccgcaccaaagttgaggctgctgaa
gaccaagcagttaaacagatgctcatcaatcagacagagaaggtcaacagcgttatgcct
gagctggaggctgctgttaagaaaaatgatgatgccttattagggccggttctagaaaac
tttttgagagtgagtgaagacgtcatgagcgaatggctcgaccataccttaggccatact
gtgaaggataatagcatttttctctccctgccgcgatattgggaagaagagtttcacaaa
gacatggaagctctcaatatatgcgtaccagatattgtatgtagagtgactgattatatt
ccagaaataattaaatatatagaacaaattcaaaataacggttttgcatatgaatcacac
aattcagtctactttgatgttacagcgttcgattcgaacagtactcaccattatgctaaa
ttagtgccggaagcagttggtgaccttaagttgttagaagaaggagaaggcgtactctca
gaaagtaaagagaaaaaatcgcccggcgattttgctttatggaaagcgtcaaaacctggc
gagccattttgggatagcccttggggcaaaggacgtccaggatggcatattgaatgttcg
gtaatggcttcgcacatttgtggcgatacactggacatccatacaggtggggtcgacttg
aaattcccccaccatgataatgaaatagcacaagccgaggcttattataaaaaagactta
tgggttaggtactttcttcattcaggacatttaaaaatcgaagggcagaagatgtccaaa
tccttgaagaattttattactattaaagaagctctgacaaagtatacagcgaggcagttg
agattgctgtttctgttacattcttggcgcgatcaactcgattacagtgattcgacaatg
ctcatggccttgaattatgagaagacgataaatgaattttttctgagggtaaaagacttc
ttgaacatttcaaaaaagactaacttcgttgataacttccacaaatatacagataacgat
gttaaaatgaaggagaagtttcagaggactaaggatgctgttcatgctgccttctgtgat
agtgtagatacaaggactgttatggagacgatcaaagagtttataagctactgccactcg
tacttagatcagaagaatgtcgacatatctctcatcgagaacatcgctttatatgttact
gatatgctcaaaatattcggcctaatatttgtaaaatcttcgattggatttccagtcaat
gtgaatgcctctgtggacgtggaagaagttctcactccatatttaaggattctaggtaac
tttagggatgatgtaagaaatagtgccaagtgttcgaaagatattgaagttttgaaattg
tgtgatcaattgagagacgatgttttaccaaatgtcggggtacgtcttgaagataagact
gaaggcccctgtacaatcaaactagtcgatagaactgtactgttggaagaacagaggatc
aaaagggaagaagctgcagctaaaatgaataaaaagaaagagaaagtgaatgtgaaacaa
aatccagaacctgttgaaccgccacaaaacatgttccgttccatgaaggacaaatattca
gcttttacagcagagggtatgccaactcatgatgcagaaggtaaagaaattagtaagggg
cagatgaagaagcttacaaaactgtaccaagctcaagaaaagaaatatgagaaatttgtt
gctgattcagctttaaaaaaataa

DBGET integrated database retrieval system