KEGG   Cimex lectularius (bed bug): 106670024Help
Entry
106670024         CDS       T05603                                 

Definition
(RefSeq) glucosylceramidase-like
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
clec  Cimex lectularius (bed bug)
Pathway
clec00511  Other glycan degradation
clec00600  Sphingolipid metabolism
clec01100  Metabolic pathways
clec04142  Lysosome
Brite
KEGG Orthology (KO) [BR:clec00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    106670024
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    106670024
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    106670024
Enzymes [BR:clec01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     106670024
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59 Alpha-L-AF_C
Motif
Other DBs
NCBI-GeneID: 106670024
NCBI-ProteinID: XP_014255482
Position
Unknown
AA seq 532 aa AA seqDB search
MNFLLNTILLSLFSQVLSFLNCKAKETDNGFLCVCDSVYCDTTPETPKLPNKYAHSIMTS
NSRPGFNADIVKFSNTEKLLNNGTVFIVNSTIVLQELRGFGGTFTDAFGLNVLSLSEKSQ
DSLLRSYFGQDGLRYRLCRVPIGGTDFSQKAYNYDNTEDDMELKHFKLADEDFVYKIPLI
KRAQILAKKKINLIASNWAPPDWMKVKTTSNSSYLKDEYYQVYADYQIRFLEEYKKRNIQ
FWGITAVNEPLTGLAIHFSINNVIMLPEQQRKWIGHFFGPSLETRGFRDIKIMTLDDQRK
YISWWMDIVMLDKEAAKYTSGIALHWYFDSHTSPEMIDEVNRKFPDKFVLYTESSINKAI
SDDVINLGSWMRGALYAYNIIENLNHWSIGWIDWNMALDMTGGPSYIGQNCDAPILIDKE
KDVFYKQPMYYMLGHFSAFTDEDSVVISLQEKTPTRTRRKRAVPPWPTPVDPVPISIPKG
IHGVAVQNKDGSKSIFLLNGHKHDANVTVIDVERGNLYLTLKPESMNSFIYW
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaattttctcttgaatacaattttattgtcactattttctcaagttttgagctttctc
aattgtaaagctaaagaaacagacaatggatttctttgtgtttgtgactcggtttattgc
gatacaactccagaaacacctaagttgccaaataaatatgcccatagcataatgacttcc
aacagccgaccaggctttaacgctgatatcgtaaaattcagcaatacggaaaagcttttg
aataacggaactgtttttattgtaaactcaacaatcgttttacaagagttaagaggtttt
ggtggcacttttacagacgcttttggacttaatgtcttaagcttaagcgaaaaaagtcaa
gactccctcctaagatcttattttggccaagatggtctaaggtacaggctttgtcgggtt
ccaattggtggcacggacttttctcaaaaagcttataattatgacaacacagaggatgat
atggagctaaagcattttaaacttgccgatgaggattttgtctataagatacctttgata
aaacgtgcacaaattctggcaaagaagaagataaacttgatcgctagcaactgggctcct
ccagactggatgaaagtaaaaacgacatcgaattcatcctatttgaaagacgagtattac
caggtttatgctgattaccaaatacgctttctagaagagtataaaaagaggaatatacaa
ttttggggtatcacggctgtgaacgaacccctgactggattggctatacatttcagtata
aacaacgttataatgttgcctgaacaacagagaaaatggatagggcatttctttgggcct
tccttggaaactagaggctttagagatatcaaaataatgactttagacgatcagagaaaa
tatatatcttggtggatggacattgtcatgttagataaagaagctgcaaagtatacttca
gggattgctctccactggtattttgacagccatacctcaccagagatgatagatgaagtt
aatagaaagtttcctgacaagtttgttttatacactgaaagcagtataaacaaagcaatt
tctgatgatgtgattaatttagggtcatggatgagaggagctttgtacgcttacaatata
atcgagaatctaaaccactggtctattggatggatagactggaatatggctctggacatg
actggaggcccaagttacatcggacaaaattgcgatgcaccaattctcattgacaaggag
aaagacgtattttataagcagcctatgtattatatgctcggtcatttttctgcattcacc
gatgaagactctgttgtgataagcttgcaagaaaagacgccaactcggaccagaaggaag
cgagctgtacctccatggcctacacctgttgatccagttccgatctccattccaaaaggt
atccacggcgtggcggtacagaacaaagatgggagcaaatccatatttctattaaatgga
cataaacatgatgccaacgttacagtaattgatgttgaaagaggaaatctttatctaaca
ttaaaaccagaatcaatgaattcttttatatattggtga

DBGET integrated database retrieval system