KEGG   Cimex lectularius (bed bug): 106670101Help
Entry
106670101         CDS       T05603                                 

Definition
(RefSeq) isocitrate dehydrogenase [NADP] cytoplasmic
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
clec  Cimex lectularius (bed bug)
Pathway
clec00020  Citrate cycle (TCA cycle)
clec00480  Glutathione metabolism
clec01100  Metabolic pathways
clec01200  Carbon metabolism
clec01210  2-Oxocarboxylic acid metabolism
clec01230  Biosynthesis of amino acids
clec04146  Peroxisome
Module
clec_M00009  Citrate cycle (TCA cycle, Krebs cycle)
clec_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:clec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106670101
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106670101
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    106670101
Enzymes [BR:clec01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     106670101
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 106670101
NCBI-ProteinID: XP_014255604
Position
Unknown
AA seq 411 aa AA seqDB search
MVVKIKAGPVVDILGDEMTRVIWDVIKEKLILPFVDVELHTYDLGIENRDKTDDKVTVEC
AEAIKKYNVGIKCATITPDEKRVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPKL
VTPWEKPIIIGRHAHADQYKATDFLVPGAGKLTLSFTPVGAKEPTIVETVHNFEGPGVTI
GMYNTDQSIEAFAHSSFKYALVRKYPLYLSTKNTILKKYDGRFKDIFQEIYEQKYKVDFE
KSGIWYEHRLIDDMVAYALKSEGGFIWSCKNYDGDVQSDSVAQGFGSLGLMTSVLVCPDG
KTIEAEAAHGTVTRHFRFYQQGKETSTNPIASIFAWTQGLAHRAKLDKNQELANFVKVLE
TVCVQTIESGYMTKDLAICIKGMNNVKREDYLETFAFLDKLAENLKIALKA
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggtggttaaaatcaaggcaggcccagttgtggacatcctaggagatgagatgacaaga
gtgatttgggatgttataaaggaaaaattaattttgccttttgttgatgtcgaattgcat
acttatgatcttggcattgagaacagggataaaactgatgataaggtgacggtggaatgt
gctgaggcaattaagaagtacaacgtagggatcaaatgcgccacgatcacccctgatgag
aaaagggtcgaggagtttaagctaaaaaaaatgtggaagtctcccaacggtacgatcagg
aatatcctcggcggtacagtattcagagagccgattatttgcaaaaacatcccgaaactt
gttactccgtgggagaagccgattataatcggcagacatgcccatgcagatcagtacaaa
gctactgatttcttggtgccaggcgctgggaaactgactctcagcttcactcccgttggc
gctaaagagccgacaatcgtagaaacagtacacaatttcgaaggtccaggagtcacgatc
ggtatgtacaatactgaccagtcaatagaagcgtttgcgcattcgtcatttaaatacgcc
ctggtcagaaagtaccctctctacctcagcactaaaaacacaattttaaagaaatacgat
ggacgattcaaagacatatttcaagaaatttatgaacagaagtacaaagtggattttgaa
aaaagtggcatttggtacgaacacaggttgattgatgatatggtcgcctatgctttaaaa
tctgaaggcggtttcatatggtcatgtaaaaattatgatggtgatgttcagtctgattct
gtggcacaaggattcggctctctcggacttatgacttcagttcttgtgtgtcctgatggt
aaaacgatcgaggcagaagcggctcacggcacggtgactcggcatttcaggttctaccag
caaggcaaagagacctcgaccaacccgatcgcttccatcttcgcctggactcaaggccta
gcccacagagcaaagcttgacaaaaaccaagaattggccaattttgtaaaagtgctggaa
accgtctgtgtacagacgatcgaatccggttacatgactaaagatttggccatttgcata
aaaggcatgaacaatgttaaaagggaagactacctcgaaacgtttgcctttttggacaaa
ttagctgaaaatctcaaaatcgccttgaaagcctga

DBGET integrated database retrieval system