KEGG   Cimex lectularius (bed bug): 106670487Help
Entry
106670487         CDS       T05603                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 2, mitochondrial isoform X1
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
clec  Cimex lectularius (bed bug)
Pathway
clec00071  Fatty acid degradation
clec01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:clec00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    106670487
Enzymes [BR:clec01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     106670487
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf TbpB_C
Motif
Other DBs
NCBI-GeneID: 106670487
NCBI-ProteinID: XP_014256388
Position
Unknown
AA seq 651 aa AA seqDB search
MKLLHLKNNLTRAHPTASECLRFFSTRPDDYQYIQRSKVPTLHFQKSLPRLPIPELSNSC
ARYLKAQRPLLLDKEYSRVEKTVKEFEKYDGPSLQAELVETDKNNRHTSYISAPWFEMYL
KDRKPLPINYNPFLVFIDGPKPEYNTQLLRGTNLLISSLRFMKSLRSNLLEPEVYHMNPK
KSDTSFFRTVTGMLPSSVSWYGAYLFKAFPLDMVQYENLFNTSRIPEAGMDRLYHDADTK
YIIVMKGGHFFKMNVLDESGDILDPQTIFTCLKYILNKDLSPAEHPVGILTTENRDKWAD
ERRHLKNIGNADLLRTIDGAIFNLIFEDDEPTTEYAKLIQKYLHSDGVNRWFDKSFSMIV
CKNGIAGLNFEHSWGDGVAILRYFQDIYKDSTEKPRVHPDAQCNNVSPETLVSQLVFKLD
DKSKKAISDAKKKYNQVTSSLGIQLHECLHFGRNLCKVHKISPDLVMQLAFQIAHYKLSG
RLVSTYESCSTAAFKHGRTETMRPCTVETAAVCKAFESSVKPGKLELLEMVKQCSKVHGN
LIKEAAMGQGFDRHFFALHLIAQKRKKVPDMFADPLFSALNHYVLSTSTLSSDVVMLGAF
GPVVQDGYGIGYSIWNERLGCIVSNYKENTDGPGLIRCIEQSLSEIHNILK
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcctacacctgaagaacaatttgacaagagcacatcccactgcttcagaatgt
ttgagattcttcagtaccaggccagacgattatcagtatattcaaaggagcaaagtgcct
actcttcactttcagaagtctcttcctcgactccccatccccgaattatcgaattcctgt
gcgagatacttaaaggctcagcgacctttattgttggacaaggaatattctagagttgaa
aaaacggttaaagaatttgaaaagtatgacggaccgtccttgcaagctgaacttgttgaa
acagataaaaataatcggcacaccagttacatttctgcaccttggtttgaaatgtatcta
aaagacagaaaacctttgccaattaactataatccttttttggtatttattgatggtcca
aaacctgagtacaatacacaacttcttcgtggaacaaatttgttgatttcatctctcagg
ttcatgaaatctcttagaagtaacctcttagaacctgaagtgtatcacatgaaccctaag
aaatcagatacaagtttctttcgaaccgtaacaggcatgttgccatcttctgttagttgg
tatggtgcttatttatttaaggcctttccgttggatatggttcagtatgaaaatttattc
aatacttcaagaattccagaagcaggaatggatagattgtaccatgacgcagatacaaaa
tatataattgtgatgaaagggggccatttctttaagatgaatgttttggacgaatcaggc
gatattttagatcctcaaacaattttcacttgtttgaaatatattttaaataaagattta
agcccagccgaacatcctgtcggcatacttactacagaaaaccgggataagtgggcagat
gagagaagacacttaaaaaacattggtaatgccgatttactcaggacaattgatggtgct
atttttaacttgatttttgaagatgatgagcccactactgaatacgccaaactaatacaa
aagtacttgcattcagatggagttaaccggtggtttgacaaatcgttttcaatgattgtc
tgtaaaaatggcattgctgggttgaactttgaacattcatggggagatggagttgccatt
cttcggtattttcaagatatatacaaagactcaacggaaaaacctagagtccatcctgat
gctcagtgcaataacgtttctccagaaacgttagtttctcaattagtgttcaaacttgat
gataaatcaaaaaaagctatttctgatgctaaaaaaaaatataaccaagttacttcctcg
ttgggaattcagctacacgagtgcttacattttggaaggaatctctgcaaagtacataaa
atcagccctgatttagtaatgcaacttgcatttcaaatcgcccattacaagttatcagga
aggcttgtttctacatatgaatcttgcagcactgcagcttttaagcatggtcggacagaa
acaatgaggccttgcactgttgagactgcagcagtatgcaaagcattcgaatcctctgta
aaacctggaaaactagagttattagaaatggttaaacaatgttctaaagtgcatgggaac
ttaattaaagaagctgcaatgggtcaaggtttcgatcgtcactttttcgcattacatttg
atcgcccaaaaaagaaaaaaggttcctgatatgtttgcagacccgctgttctctgcttta
aatcattatgtcctttcgacatcaacccttagctcagatgttgttatgttgggagccttt
ggacctgtcgtacaagatggatatggaatcggttattctatatggaatgaacgattggga
tgtatagtgtcaaattataaagaaaatacagatggccctggattaatacgatgcattgaa
caaagcctatcagaaattcacaatatattgaaataa

DBGET integrated database retrieval system