KEGG   Cimex lectularius (bed bug): 106670574Help
Entry
106670574         CDS       T05603                                 

Definition
(RefSeq) heat shock protein 68-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
clec  Cimex lectularius (bed bug)
Pathway
clec03040  Spliceosome
clec04141  Protein processing in endoplasmic reticulum
clec04144  Endocytosis
clec04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:clec00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    106670574
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106670574
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106670574
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    106670574
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:clec01009]
    106670574
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:clec03041]
    106670574
   03009 Ribosome biogenesis [BR:clec03009]
    106670574
   03110 Chaperones and folding catalysts [BR:clec03110]
    106670574
   04131 Membrane trafficking [BR:clec04131]
    106670574
   03051 Proteasome [BR:clec03051]
    106670574
   03029 Mitochondrial biogenesis [BR:clec03029]
    106670574
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:clec04147]
    106670574
Protein phosphatases and associated proteins [BR:clec01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     106670574
Spliceosome [BR:clec03041]
 Complex B
  Other components
   Prp19 complex
    106670574
 Complex C
   Prp19-CDC5 complex
    106670574
Ribosome biogenesis [BR:clec03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    106670574
Chaperones and folding catalysts [BR:clec03110]
 Heat shock proteins
  HSP70 / DNAK
   106670574
Membrane trafficking [BR:clec04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    106670574
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    106670574
Proteasome [BR:clec03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    106670574
Mitochondrial biogenesis [BR:clec03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    106670574
Exosome [BR:clec04147]
 Exosomal proteins
  Proteins found in most exosomes
   106670574
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl StbA DUF3153 FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 106670574
NCBI-ProteinID: XP_014256533
Position
Unknown
AA seq 639 aa AA seqDB search
MTAIGIDLGTTYSCVGVWQHGKVEIIANDQGNRTTPSYVAFTETERLIGDAAKNQVAMNP
QNSVFDAKRLIGRKFDDPKIQDDMKNWPFKVVNDSSKPKIQVEFKGEVKKFAPEEISSMV
LVKMKEIAEAYLGKKVKDAVITVPAYFNDSQRQATKDAGAIAGVNVLRIINEPTAAALAY
GLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDTHLGGEDFDNRLVNHLA
EEFKRKYKKDLKQSPRALRRLRTAAERAKRTLSSSTEASLEIDALYEGIDFYTKITRARF
EELCSDLFRSTLLPVEKALQDAKLDKGAIHDVVLVGGSTRIPKIQTLLQNFFNGKALNMS
INPDEAVAYGAAVQAAILSGDQSSQIQDVLLVDVAPLSLGIETAGGVMAKIIERNTRIPC
KQSQTFTTYSDNQPAVTIQVFEGERAMTKDNNLLGTFDLTGIPPAPRGVPKIEVTFDLDA
NGIMNVSAKENNTGKSKNIVIKNDKGRLSKEEIDRMVNDAERYKAEDDKQRERISARNQL
EAYVFNAKQAAEDCGDKLSQSEKDTVKSRCDEAIRWLDNNSLAEKEEYEHKLSELQKELT
MYMTKLHSGQSSQGGYPGGDFGMPSANKNQSGPTIEEVD
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgacagcgattggaattgatcttggaacgacgtattcctgcgttggagtttggcagcat
ggaaaggtggagatcatcgccaacgaccaaggcaacaggacgacaccgagttatgttgca
ttcacagaaactgaacgtctcatcggtgatgcggcaaaaaaccaagtcgccatgaatccc
cagaactcggttttcgacgccaagaggctcatcgggaggaaatttgacgacccaaagatc
caggacgacatgaagaactggccttttaaagtcgtcaatgattcttccaagcccaagatc
caggtggagttcaaaggcgaggtgaaaaagttcgccccagaggagataagctcgatggtg
ttggtgaagatgaaagaaatagcggaggcttatctaggcaagaaagtgaaagatgcagtc
atcactgtaccagcttatttcaacgactcgcagaggcaagcgactaaagatgcaggagct
atcgccggtgtcaacgtactgcggatcatcaacgagccgactgctgctgctttggcttat
ggattggacaaaaacttaaaaggcgagaggaatgtactaatatttgatctaggaggaggt
acttttgacgtatcgatcctgactatagacgaaggctccctttttgaagtgagatcgact
gccggtgacacccatttaggaggtgaggacttcgacaatcgacttgtaaatcatttggcc
gaagagttcaaaagaaagtacaaaaaagatcttaaacaaagccctagggctttgaggagg
ctgagaactgcggccgaaagggctaaacgaactctttcttcaagcacagaagcatcgtta
gaaattgacgctctttatgaaggcatagatttctacacaaaaatcaccagagcgaggttt
gaagagctttgctctgacctctttagatccactctactcccagtagaaaaagccctacaa
gacgccaagttggataaaggagccatacacgatgtggtattagtcggaggttcaacgagg
ataccaaaaatacagacccttttgcaaaatttcttcaatggtaaagcactgaacatgtcg
atcaatcctgatgaagcagtagcctacggagcagctgttcaagcggcgattctcagtggc
gatcaaagttcacaaatccaagacgtgctgttagtcgatgttgcacctttatcccttggt
atcgaaactgctggaggagtgatggccaaaatcatagagagaaatacaaggataccgtgc
aaacagagccagaccttcactacctactcggacaatcaaccggcagttactatccaagtg
tttgaaggcgagagagctatgacaaaagacaacaacttgctcggaactttcgatctcacg
ggcatcccacctgcaccaaggggtgtgcctaaaatagaagtcaccttcgatttggatgca
aacggtattatgaacgtctccgctaaagaaaacaacacaggaaagtccaagaacatcgtc
ataaaaaatgacaaagggaggctatctaaagaagaaatcgacaggatggtcaatgatgca
gaaagatacaaagctgaagatgacaaacaacgggaaaggatctccgcaaggaaccaactc
gaagcttatgtgtttaatgcaaaacaagctgctgaagattgcggagacaaacttagccag
tctgagaaagacactgtaaaatcgcggtgcgacgaagccatcaggtggctcgacaacaac
tccctcgctgaaaaagaagaatacgagcacaaactatcggaacttcaaaaagaactcacg
atgtacatgacgaaactgcattcaggccaaagttcacaaggtggctacccaggaggcgat
tttggaatgccatccgcaaacaaaaaccagtctgggcccaccatcgaagaagtagattaa

DBGET integrated database retrieval system