KEGG   Cimex lectularius (bed bug): 106670911Help
Entry
106670911         CDS       T05603                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
clec  Cimex lectularius (bed bug)
Pathway
clec00970  Aminoacyl-tRNA biosynthesis
clec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clec00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    106670911
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:clec03029]
    106670911
Enzymes [BR:clec01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     106670911
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     106670911
Mitochondrial biogenesis [BR:clec03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    106670911
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-GeneID: 106670911
NCBI-ProteinID: XP_014257069
Position
Unknown
AA seq 144 aa AA seqDB search
MSFALRRVFPQVLRSFCCKVPNSPVPGIDTSRLPKETKIGKELIEHLESISLVDFGNEKG
VRIVEEAIRFADQLTVVDTEGVQPLTSVLEDRSLPLRADVVTEGNCRPDILGNAKKTDEG
YFVAPPGNIPLKPKVENPLKEANN
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcgctcttaggagagtatttccgcaggtgttgagatccttctgctgtaaagtt
ccgaattcgcccgtccctggtatagacacgtctaggttaccaaaggagaccaaaatcgga
aaagagctgatagaacatctcgagagcatatctctcgtcgattttggtaatgaaaagggc
gtcaggatcgttgaggaagccatcagattcgcagaccagctcaccgtcgtagacacagaa
ggcgtacaacccttaacctccgtattggaagacagatcgcttcccctccgtgccgacgtc
gtgactgaaggaaactgccgcccagatatactgggcaatgcgaaaaagacggacgagggt
tacttcgtcgcaccgcctggcaatatacccctgaagccgaaagtagaaaacccgctgaaa
gaagccaataattag

DBGET integrated database retrieval system