KEGG   Cimex lectularius (bed bug): 106671553Help
Entry
106671553         CDS       T05603                                 

Definition
(RefSeq) succinate-semialdehyde dehydrogenase, mitochondrial isoform X1
  KO
K00139  succinate-semialdehyde dehydrogenase [EC:1.2.1.24]
Organism
clec  Cimex lectularius (bed bug)
Pathway
clec00250  Alanine, aspartate and glutamate metabolism
clec00650  Butanoate metabolism
clec01100  Metabolic pathways
Module
clec_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:clec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    106671553
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    106671553
Enzymes [BR:clec01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     106671553
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 106671553
NCBI-ProteinID: XP_014257953
Position
Unknown
AA seq 507 aa AA seqDB search
MQVALRKPLSTVVNILIKQGITKMETRHIQNHAYINGNWVKSLSGKTFDVFNPSNGELIT
NVPDMNVEDVKCAVDAAAESFLTWSLTTAKERGQLLRQWYNILNENSEKLAKLVQLEAGK
PFSEALGEVAYGNAFIDWFSEEARRCYGEVLCSPVKNKELMHIKQPIGVAALLTPWNFPH
AMITRKAGAALAAGCTCVIKPAEDTPLTALALAEYAEKAGIPKGVINVVTCDRPSVGAVG
KFLCETPLVSVITFTGSTVVGKLLFNQCAPSVKRISLELGGNAPFIVFKTADVSKAVLGA
VASKFRNCGQACISANRFLIEESVFDQFVNEFTSYVKENISFEPDTQKQQIGPLINDMQV
KKVTAIVDDAISKGAQVKLGGKVAKNKGKLYFEPTVLTNIKPDMVCYREEIFGPVAPCIK
FSNEEEALRIANDTKTGLAGYFYSNDISQIFRVSKKLQVGMVGINEGAISTPEAAFGGIK
ESGIGREGSHYGMDEFINIKYLCFGNL
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgcaagttgctttacgaaagcctttatccacggtagttaacatattaataaaacaagga
ataacgaaaatggaaacaaggcatatacaaaatcatgcctacattaacggaaattgggta
aaatcgttaagtggcaagacatttgatgtgttcaatccatcaaatggagagttgataaca
aatgtcccggatatgaacgtggaagatgtaaagtgtgctgtagatgctgccgcagagtcc
tttctcacttggagtttaaccactgctaaggaacgtggtcaacttttaagacaatggtac
aacattttaaatgaaaattctgaaaaactcgccaaactggttcaactggaagctggaaaa
cccttttctgaagctctcggtgaagtggcttatggaaacgcctttatcgattggttttca
gaagaagctcgtcgttgttatggggaagttttatgcagccccgtgaaaaacaaagaactt
atgcacataaagcaaccgattggggttgcggcattgttaacaccttggaattttccgcat
gcaatgataacaagaaaagctggagcggctcttgctgctgggtgcacttgcgtaataaaa
ccggctgaagatactcccttgactgctttagccctcgcagaatatgctgaaaaagcaggt
attccaaaaggtgtcattaatgtagtaacatgtgatcggccgtctgtaggagctgttgga
aaatttctctgtgagactcccctagtatctgtaataacatttacaggctcaactgtggtt
ggtaaattattattcaaccaatgtgccccaagtgtcaaaagaatttcattggaactaggc
ggtaatgctccatttattgtcttcaaaacagcagatgttagcaaagctgtcctaggtgct
gttgcttcaaaatttagaaactgtgggcaggcatgcatcagtgcaaatcgatttcttatt
gaagaaagcgtctttgatcaatttgtcaatgaatttacgtcatatgttaaagaaaatatt
tcttttgaacccgatacacagaaacaacagattggaccattgataaatgatatgcaagtt
aaaaaggtgactgccattgtggatgatgccatttcaaagggagcccaggttaaacttgga
ggaaaagtggccaagaacaaaggaaaactatatttcgagccaacagtactcacaaatatt
aaacctgatatggtttgctacagagaagaaatttttggtcctgttgcaccatgtattaag
tttagcaatgaagaagaagcgttaaggatcgcaaatgacaccaaaacaggtctagctggt
tacttctactccaatgacatatcacaaatcttcagggtttcaaagaaattacaagtcggg
atggtgggtataaatgaaggtgctataagcactcctgaagcagcatttggtggaataaag
gaatcggggatcggtagagaggggtctcattatggcatggatgagttcatcaacataaaa
tatttatgttttggtaacttataa

DBGET integrated database retrieval system