KEGG   Cimex lectularius (bed bug): 106672500Help
Entry
106672500         CDS       T05603                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like isoform X2
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
clec  Cimex lectularius (bed bug)
Pathway
clec00010  Glycolysis / Gluconeogenesis
clec00562  Inositol phosphate metabolism
clec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106672500
   00562 Inositol phosphate metabolism
    106672500
Enzymes [BR:clec01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     106672500
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     106672500
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 106672500
NCBI-ProteinID: XP_014259492
Position
Unknown
AA seq 464 aa AA seqDB search
MLAIWFLVAALLLGGIRSAQDDTYYCLAEDNERYEYFGELTSYENVRNQRLPTKLPKCTP
VALWSFISNGATYPDTSDYNSIALMQLQQGIILNNSEKRNKLCHEDFDAIQNWTDGLRNW
PPETLEPKYKSFINNLGQIYVNRYPEIFKSAYEEIFVRISPRKNSKETYEEFKNGMNKAG
FNVSTIYESVTPVAPVTTNCSQWDQSQLAKANEKRDEFRRGPEVSQMLKEINERLGFPKF
GGLAMSDIEAMYKMCRLDRMFSNLTDSPWCAAFKPEHLKVLEYDEDLYSFYLSGYGNPLV
DDMACPLLKNLMETLYNNTVNGTSPQSVLYFGDVTTLRYILTGLGIVQDDDGRGLSPKPG
PLLNERQWRLSVISPPLANLAVVLYKCTFGVNYQLMFYLNDHPVDYKGCKVGLCNWNDIY
NSFQTAIKSESCDREVVCSESSSAPVGYSTSLAWLVLVISAVIY
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgttggcgatctggttcctcgtcgctgcactcctgctgggtggtattcgttctgctcaa
gacgacacctattactgcttagctgaggacaacgaacgctacgagtacttcggagagctg
acgtcctatgagaacgttcggaatcaaagacttcccactaagttgccaaaatgcactcca
gtggccctgtggtcgtttatatccaatggagctacatatcccgacacgtctgactataat
tctatagcactcatgcaattacaacagggcattattctaaataacagtgaaaaaagaaat
aaactctgccacgaggattttgacgccatacaaaattggaccgacggtttacgcaattgg
ccccctgaaacgttggagccaaaatacaaaagctttataaacaatcttgggcagatttac
gttaaccgctaccctgaaattttcaaaagcgcgtatgaggaaatatttgtacggatctct
ccgaggaaaaactccaaggaaacatacgaagaatttaaaaatgggatgaacaaagctgga
ttcaacgtgtcgaccatatatgagtctgtgacgccggtggcgcccgtcacgaccaattgc
tcgcaatgggaccagagtcaactagcaaaggcaaatgagaagcgagatgaatttagaagg
gggccagaggtgagccagatgcttaaagaaatcaacgaaaggcttggcttcccgaagttc
ggaggactagcgatgtccgatatcgaggcaatgtacaaaatgtgcagattggaccgaatg
ttctccaatctcacggactccccttggtgcgctgctttcaagcctgaacatctgaaagtg
ttggagtacgacgaggatctgtactctttctacttatccggctatggaaacccgttggta
gatgatatggcttgtcctttgctaaaaaatctcatggaaacgctttacaacaacactgtc
aatgggacttcgcctcaaagcgtactatatttcggcgatgtcacgactctccggtatatt
ttgaccgggctgggtattgttcaagatgacgacgggcgtgggctttcacctaaaccggga
ccccttttgaatgaaaggcagtggcgactgtctgtgatatctcctccattagccaatctt
gctgttgtgctttataagtgtacctttggagttaattatcaattaatgttctacctaaat
gaccacccggttgactacaaagggtgcaaagttggcctatgcaattggaacgacatttac
aacagttttcaaactgcaatcaaatctgagtcctgtgatcgtgaagtagtgtgtagtgaa
tcgtcatccgctccagtcggttactcgactagtctcgcatggctagttcttgtaatcagt
gccgtaatctattaa

DBGET integrated database retrieval system