KEGG   Cimex lectularius (bed bug): 106673629Help
Entry
106673629         CDS       T05603                                 

Definition
(RefSeq) uncharacterized protein LOC106673629
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
clec  Cimex lectularius (bed bug)
Pathway
clec00260  Glycine, serine and threonine metabolism
clec01100  Metabolic pathways
clec01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:clec00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    106673629
Enzymes [BR:clec01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     106673629
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 106673629
NCBI-ProteinID: XP_014261297
Position
Unknown
AA seq 415 aa AA seqDB search
MHARIFCRSLRQLNEAKNYFEVGKASIYNAQESLTYPKNVRIVDYRSDTFSKPSKEMRQV
MFEAKVGDDVYGEDPTVNALEEKGAKMLNKETSLFVASGTMANLLAIMTHADNRGCEIIV
GEDSHILLWEQAGAAQIAGVQLRSVPNFPNGTFSVKEMLQKFRRSQNFQPRTSLVCVENT
HNSCGGRVTPLSWLRELSDALKDTGVPLHMDGARFFNSVVSSKVPAHEIVRDCDSINVCL
SKGLGAPIGSLLIGKADFIHKARQLRKVLGGGMRQVGLVAAAGIYALDHMVERLEEDHIH
ARTVAKGIHDMKSQVVQVDLDSLETNILLIHVDTHVITSQQFCKRLASITKDELDEGIET
AVKILPWTTNIARLVVCCNNNAEDAEATVKKMQFVIRELDEHAKLNMTSRVEDRR
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcaaggatattttgcagatctttaagacagctgaatgaagctaaaaactatttc
gaagttggtaaagcctcaatttacaatgctcaagaatcgttgacctatccaaaaaatgtg
aggattgtcgattatcggagtgatacattctccaaacctagcaaagaaatgagacaggtc
atgtttgaagcaaaagtaggagatgatgtatacggagaggatccaactgttaatgcactg
gaagaaaaaggtgcgaaaatgttaaataaagaaacatcactatttgtggcaagtggtacc
atggcaaatctattggcaataatgacccatgcagataatcgtggctgtgagataatagtc
ggtgaagatagtcatatattattatgggaacaagctggtgccgctcagattgcaggtgta
caacttcggagcgttcctaactttcccaatggcacattcagtgttaaagaaatgcttcag
aagtttagaagaagtcaaaattttcaaccacggacatcgcttgtgtgcgttgaaaacacg
cacaattcttgtggagggcgagtcactcctctcagttggcttagagagctcagtgatgcg
ctgaaagatactggagtgcctcttcacatggacggagctagatttttcaacagtgtcgta
agctccaaagtcccagcacacgagattgtgcgggattgcgattctatcaatgtatgcttg
agcaaagggctaggtgcgccaatcggaagtttgcttataggcaaagccgatttcatccat
aaagctaggcagttgagaaaagtccttggaggaggtatgagacaagttggtttagtggca
gccgctggaatttacgctcttgaccatatggtcgaaagattggaagaagatcatattcat
gcaagaactgtggctaaagggattcacgatatgaaaagccaagtagtgcaggtggatttg
gacagtttggaaacgaatattcttttgattcacgttgatacacatgttatcacatcccaa
caattctgcaaacgacttgcttcaattaccaaagacgagttagacgaaggcattgaaaca
gcagtcaaaatcctaccatggacaacgaacatagctaggcttgtggtctgttgcaacaat
aatgccgaagatgctgaagcgacagttaagaaaatgcaatttgtaatcagggaacttgat
gaacacgcaaaacttaatatgacatccagggttgaggatagaagataa

DBGET integrated database retrieval system