KEGG   Cimex lectularius (bed bug): 106673897Help
Entry
106673897         CDS       T05603                                 

Definition
(RefSeq) titin
  KO
K12567  titin [EC:2.7.11.1]
Organism
clec  Cimex lectularius (bed bug)
Brite
KEGG Orthology (KO) [BR:clec00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:clec01001]
    106673897
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:clec04131]
    106673897
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:clec04812]
    106673897
   04147 Exosome [BR:clec04147]
    106673897
Enzymes [BR:clec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106673897
Protein kinases [BR:clec01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   106673897
Membrane trafficking [BR:clec04131]
 Others
  Actin-binding proteins
   Others
    106673897
Cytoskeleton proteins [BR:clec04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     106673897
Exosome [BR:clec04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106673897
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 fn3 Ig_2 ig BSMAP DUF2407_C
Motif
Other DBs
NCBI-GeneID: 106673897
NCBI-ProteinID: XP_014261759
Position
Unknown
AA seq 1193 aa AA seqDB search
MGSGGSKHKPQGSRAHPQHPEKPSPPGKPYLIPGTPSDPDVVTIRWEQPIFNGGSKITGY
LVEHKRTGSPHWVKATPLMVRHTQLSLSGLEPGMRYQFRVWAENAFGRSDHSELSEPLAI
SYGRSGVSIAPVFSRSLNDIVAIENEMVEFLVRVEGTPLPKISWYKDGFEVFSNRRQKVS
TDCDISSFIIHQAALSDEGEIKCSATNKAGHAVTKARLTLEAPPSIRLPRQYEDGLLFEL
GEMMRLKVLVTGRPLPSVTWLHNGEEVKTSSRLDLATTDRYAMLRVTEATREDRGEYQVK
AKNKIGDDIASFLVTITDRPLPPGKVNVVMTLGRCVTLAWTAPHDDGGCKIGNYIVEYYR
IGWNMWLKAATCRQLTTTIGDLIEGSEYKFRVKAENPYGISDPSPDSDTVFIPDPKRGLL
EPPPKGTKAHVDDMPDQWLKTRKSQIEKNPQVTMPRKIQDFEWDEDESLLPSPVILANQV
LRKVKMAPKRTWSEDSQGSPPREPSPKPAPIPPKRKHRPTNQPEAPKRIHKISEESQPEW
NRSFSPGDDLHSSSEMMLVLVGNSRAETEERDLEPRLTAQELKDGTYVAPPMSLSAPVIG
VCDPISSHSLRPWGSSSDLMYELTLARFNKEVDEEEIESKVKRRYGVERKRSFEQKRHSK
TREEILSELKEKTTSLENIQEQENMAEIRDASPLRKISNASDIDDERGKRNYDQFSERFM
MLEKSFQDYTSKYEIEEGPISDLDSMGRSFDYTEDEVEEEPYHPRLGKGTFTPITIDMPK
SEEVRSKFQGNLSPIVIPNDKKSPSPGPVPAITLNDHPQNVNDEVKTEKQEIISAMGSPS
PKKKIETNEIQRSPSPKVVKDRSRERKERSPSPKQRYSMPYKLEDESRERSLSPKHRYTM
PPENELEQRHIRDVRSRTPSPQQINPPKILIAMPQPTTPNTLTEPVVLRKRSPSPKAPVE
TTQHPLSKLPKPILKVRDQSLDRSELSDSELGHSKKVRIEVPQDKQNIDRFATEENDIGL
HAGEVARNRRRQVKSQNFEDQDDTKVVVSHYSDIVREFGHPKKPVPKLYLSYEELKAAAD
KIQEEMSTPAIFDKMEKQTIQEQKKQKEEAEKKEKAEEKEVPNENELNLVQVPRKKNLLL
SYMLDLFLFLIACWLYIFHDPKLVIPLLLLMIYRQLSDSLHGKLSFGWGKKKE
NT seq 3582 nt NT seq  +upstreamnt  +downstreamnt
atgggttctggagggagtaaacacaagccccaggggagcagggcgcaccctcagcatccc
gaaaagccctctccccctggaaagccgtatctgataccaggaacgccgtcggacccggat
gttgtaactataagatgggaacagccaattttcaacggaggatcaaaaataacaggttac
ctcgtagaacacaagcgaacagggtcgcctcactgggtaaaagccacacctttgatggtg
cggcacactcagttgagcctgagcggccttgagccggggatgaggtaccaattccgggtc
tgggcagaaaacgctttcggccgatcggaccacagtgagctctccgaaccacttgccata
tcttacggaaggtctggagtgtccatcgcaccggtgttttctcggagtttgaatgacatt
gtagcaattgaaaatgaaatggtggaattccttgtaagggtcgaagggacaccgcttcct
aagatatcgtggtataaagatggttttgaagttttcagcaacagaagacagaaagtttcg
acagactgtgacattagtagttttatcatccatcaagctgctctaagcgatgagggagag
ataaaatgttcagctactaacaaagcaggacatgcagttaccaaagctaggctcacactc
gaagcacccccatcaatccggcttcctcgacaatacgaagatggactgctttttgagttg
ggggagatgatgcggctcaaggtgctcgtcactggaaggccgctcccatctgtcacatgg
ttgcacaatggtgaagaagtcaaaaccagctcgaggctagatcttgcgactaccgatcga
tatgctatgctgagagtcactgaagcaacaagagaagacagaggggaatatcaagtcaaa
gctaaaaacaaaattggagatgacatcgcttcttttctagtcacaataacagaccgacca
ctacctcctgggaaagtcaatgttgtcatgactctcggtcgttgtgtgaccctggcttgg
actgcccctcatgatgacggaggatgtaaaatcggaaactacatcgttgaatactacaga
attggctggaatatgtggttgaaagctgcgacttgccgacaattgacaacgacaataggt
gatctaattgaaggatctgaatataaatttcgagtcaaagcagagaatccttacggaatc
agcgatccgagccctgattccgatacagtctttatccccgaccctaaaagaggattgttg
gagccgccgcctaagggtactaaggcccatgttgatgatatgcctgaccaatggcttaaa
acaagaaaatctcagattgagaaaaatcctcaagtgacaatgccacggaaaattcaagac
tttgaatgggatgaagatgaaagtcttcttccttccccagttatattagccaaccaggtt
ttgaggaaagttaaaatggcaccgaagagaacctggagtgaggatagtcaagggtcgcca
ccgagggagccatcacctaaaccagcaccaataccgccaaagaggaaacacaggccaaca
aaccagcccgaagcgcccaagaggatccacaagatctcagaggaatcccagcctgaatgg
aatagaagtttcagcccgggagatgatctacacagcagttctgagatgatgctggttctc
gtcgggaatagcagagcagaaacagaagaaagagatttagagccaaggttgactgctcaa
gagctgaaagatgggacatacgttgcaccccctatgtcactgtcagcacctgtaatagga
gtttgtgatcctatttcttcccacagcttgagaccctggggcagttcttcagatttgatg
tatgaattgactctggcacgttttaacaaagaagttgacgaggaagagattgaatcaaag
gtcaaaagacgatacggcgttgagagaaagcgcagctttgagcagaagagacactcaaaa
acaagagaggaaattctgtctgagttaaaggagaaaacgacctcattggaaaatatacaa
gaacaagaaaacatggcggaaataagagatgcctctcctcttcgtaaaatatccaacgct
agcgatattgatgacgaaagaggaaagagaaattacgatcagttttcagaaagatttatg
atgcttgaaaaaagctttcaagattacacttccaaatatgaaattgaagaaggacctatc
tcagatttggatagcatgggaagatcatttgattacacagaagatgaggttgaagaagaa
ccttaccatccgaggcttggaaaaggaacttttacacctattacaattgatatgcccaaa
agtgaagaagtaagatcaaaatttcaaggtaacctttcaccaattgtaattccaaacgat
aaaaaatcaccctctcctggaccagttccagcaataactttaaacgaccatccacaaaat
gtaaatgatgaagtcaaaacagagaaacaagaaattataagtgctatgggatcaccttct
cctaaaaagaagatagaaacaaatgaaatacaaaggtcgccttcaccaaaggttgttaag
gatcgctctcgagaaaggaaagaaagatcaccatcacctaaacaaagatattccatgcct
tataaattagaagatgagtcaagagagagatcgctttcacctaaacatagatacacaatg
cctcctgagaatgaactagaacaaaggcacattagagatgtgcgcagcagaacaccttca
cctcaacaaatcaatcctccaaaaattttaattgcaatgccacaacccactacgccaaac
actttaacagagccagtcgttctgagaaagaggtcaccatctcctaaagcaccagttgaa
acaacccagcacccgctttccaaactgccaaaaccaatattgaaagtaagagaccagtcg
cttgacaggtctgagctcagcgattcagaacttggccattcgaaaaaagttaggatagaa
gtaccacaagacaaacagaacatagacagatttgctacagaagagaacgacatcggtctt
catgctggcgaggttgctagaaatagacgtaggcaagtcaaaagtcagaacttcgaggat
caggatgatacgaaggtggttgtaagtcactacagtgatattgtcagggagtttggccat
cctaaaaaacctgtgcctaaattatatcttagttacgaagaactgaaggcagcggcagat
aaaatacaagaagaaatgagcactccggccatttttgataaaatggaaaaacaaactata
caagaacaaaagaaacaaaaagaagaagcagagaaaaaagaaaaagcagaagagaaagaa
gtaccaaatgaaaacgaattgaatctagttcaagtgccaagaaagaagaatttattactc
tcttatatgcttgatctttttttatttctaatagcctgctggttatacatcttccatgac
ccgaagctggtcattcctctattgttattaatgatttatcgacaactaagcgattcccta
catgggaaattaagttttgggtggggaaaaaagaaagaatga

DBGET integrated database retrieval system