KEGG   Cimex lectularius (bed bug): 112126384Help
Entry
112126384         CDS       T05603                                 

Definition
(RefSeq) phosphopantothenoylcysteine decarboxylase
  KO
K01598  phosphopantothenoylcysteine decarboxylase [EC:4.1.1.36]
Organism
clec  Cimex lectularius (bed bug)
Pathway
clec00770  Pantothenate and CoA biosynthesis
clec01100  Metabolic pathways
Module
clec_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:clec00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    112126384
Enzymes [BR:clec01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     112126384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-GeneID: 112126384
NCBI-ProteinID: XP_024081178
Position
Unknown
AA seq 185 aa AA seqDB search
MVNLLVCCTGSVATIKLPVILELFKLHRNELDVNIKVCLTEKSRHFSPNELGVQSFTDSD
EWDCWNGRGDPVLHIDLTKWADVLLIAPLDANTLGKIASGICDNMVTCVVRAWEISKPLF
FCPAMNTKMWNHPITGTQISLLKSWGYYEIPCISKTLMCGDVGLGAMAEPQQIVDTVLNF
IRLNN
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacttgttagtttgctgtacagggagtgtggcgacgatcaaactacccgtcata
ttggaactgttcaaattgcatagaaatgaattagatgttaacataaaagtttgcctcaca
gagaaatcgagacatttttcccccaatgaactcggcgttcagtcattcaccgattcagat
gaatgggattgttggaatggtagaggcgatcctgtacttcacatcgatttgaccaaatgg
gctgatgtactcctcattgcccctctcgatgctaacactctcgggaaaattgccagcggg
atttgcgataacatggtcacatgtgtggtgcgcgcttgggagatttccaagccgttattc
ttctgccctgccatgaacacaaaaatgtggaaccatccaataactggcacacagatatct
ttgctgaagtcttggggctactatgaaataccgtgcatctctaaaaccctgatgtgtggc
gatgttgggctaggtgcgatggctgaaccgcagcaaattgttgatacagtgttgaacttt
attagattaaataactga

DBGET integrated database retrieval system