KEGG   Caldisphaera lagunensis: Calag_0570Help
Entry
Calag_0570        CDS       T02380                                 

Definition
(GenBank) 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
clg  Caldisphaera lagunensis
Pathway
clg00010  Glycolysis / Gluconeogenesis
clg00020  Citrate cycle (TCA cycle)
clg00620  Pyruvate metabolism
clg00640  Propanoate metabolism
clg00650  Butanoate metabolism
clg00680  Methane metabolism
clg00720  Carbon fixation pathways in prokaryotes
clg01100  Metabolic pathways
clg01120  Microbial metabolism in diverse environments
clg01130  Biosynthesis of antibiotics
clg01200  Carbon metabolism
Module
clg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:clg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calag_0570
   00020 Citrate cycle (TCA cycle)
    Calag_0570
   00620 Pyruvate metabolism
    Calag_0570
   00640 Propanoate metabolism
    Calag_0570
   00650 Butanoate metabolism
    Calag_0570
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Calag_0570
   00680 Methane metabolism
    Calag_0570
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Calag_0570
Enzymes [BR:clg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Calag_0570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR GAPES3
Motif
Other DBs
NCBI-ProteinID: AFZ70329
UniProt: L0AA77
Position
complement(548439..548999)
Genome map
AA seq 186 aa AA seqDB search
MYLELRFHGRGGEGAVTAATILARAAVLENKYAQAIPNFSAERRGAPVEVYSRISDKPIE
KHSQVRNPDAVIVLDYELIKMVNVLDGLKPNGIAIVNSPVKEPLNNVKTYCVDATKIAKA
HNLVVSGWPTVNTAILGAVSKSLGIVSIDSISKAIMDHFSSPNIAKANASAAIDAYKETS
LCGGPY
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtatttagagctgagattccatggtagaggcggtgagggagcagtaactgccgctaca
atattagccagagcagcagtattagagaataaatacgctcaagcaataccaaattttagc
gctgaaagaagaggggcccctgtagaagtttactccagaatatctgataagccaatagaa
aaacatagccaagtaagaaatccagatgcagtaatagtattggattatgagcttataaaa
atggtaaatgttttagatggcttaaagccaaatgggatagcaattgttaactccccggtt
aaagaaccattaaacaatgtaaaaacatattgtgttgatgcaacaaaaattgcaaaagct
cataatttagttgttagtggttggcctacagtaaatactgctatcttaggggcagtatca
aaatccttaggtatagtttctatcgattctattagtaaagcaattatggatcatttttca
tcacctaatattgctaaagctaatgcatcagcagctatagatgcatataaagaaacttcc
ttatgtggtggtccatattga

DBGET integrated database retrieval system