KEGG   Caldisphaera lagunensis: Calag_1272Help
Entry
Calag_1272        CDS       T02380                                 

Definition
(GenBank) cytidyltransferase-related enzyme
  KO
K00952  nicotinamide-nucleotide adenylyltransferase [EC:2.7.7.1]
Organism
clg  Caldisphaera lagunensis
Pathway
clg00760  Nicotinate and nicotinamide metabolism
clg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Calag_1272
Enzymes [BR:clg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     Calag_1272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: AFZ70988
UniProt: L0AAP3
Position
1270559..1271110
Genome map
AA seq 183 aa AA seqDB search
MLLFIGCINLVERALIYGRFQPFHLGHLSLVKWSFEQGFDEVAILVGMASENYTPRNPFT
AGERIEMARLSLKDSGIPLDKVITATIPTLEISIGCAYYVLSYIPKVKAILTRNPVISKA
FADAGIEVITPPIFNRNEWRGQYIRELMAKNDSKWKNYVTPSVVSYIEEINGIERVRKIN
SED
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgttattatttattgggtgtattaatttggttgagagagcactaatatatggaagattt
caaccatttcatttagggcacctaagcctagtaaagtggtcatttgagcaaggatttgat
gaagttgctatacttgttgggatggcatcagaaaactacacccctagaaatcctttcaca
gcaggagaaaggatcgagatggccaggttatctttaaaagacagtggaataccattagat
aaagttataacagcaacaattccaaccctagaaataagcataggctgtgcatattatgta
ttatcttacatacctaaggttaaggcaatattaacaagaaaccctgttataagtaaagca
tttgcagatgcaggtattgaagtaataactccccctatttttaatagaaatgagtggaga
ggacaatatataagagaattgatggcaaaaaatgatagtaaatggaagaattatgtaacg
ccttctgtagttagttatattgaagaaataaatggaatagaaagggttagaaaaataaat
tccgaggattag

DBGET integrated database retrieval system