KEGG   Cellulophaga lytica HI1: IX49_06960Help
Entry
IX49_06960        CDS       T03279                                 

Definition
(GenBank) succinyl-CoA:3-ketoacid-CoA transferase
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
clh  Cellulophaga lytica HI1
Pathway
clh00072  Synthesis and degradation of ketone bodies
clh00280  Valine, leucine and isoleucine degradation
clh00650  Butanoate metabolism
clh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    IX49_06960
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    IX49_06960
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IX49_06960
Enzymes [BR:clh01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     IX49_06960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: AIM60272
UniProt: A0A1L7EC68
Position
complement(1568622..1569275)
Genome map
AA seq 217 aa AA seqDB search
MLDKNGIAKRIAKEVQDGFYVNLGIGIPTLVANFVNNDISVEFQSENGVLGMGPFPFEGE
EDADIINAGKQTITTLPGASFFDSATSFGMIRGQHVDLTILGAMEVSENGDIANWKIPGK
MVKGMGGAMDLVASAENIIVAMMHTNRAGESKLLDKCTLPLTGVGCVKKIVTNLAVLEVT
KEGFLLLERAPGVTVDEIKKATKGTLIVDGDVPEMDI
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgctagataaaaacggaatagctaaacgcattgcaaaagaagtacaagacgggttttac
gtgaatttaggtattggcatacctactttagtagctaattttgtaaacaatgatataagt
gttgagtttcagagtgaaaatggcgtattgggcatgggccctttcccttttgaaggagaa
gaagatgctgatatcattaatgctggtaaacaaaccataacaactttaccaggagcttct
ttttttgactctgcaacaagttttggtatgattagagggcaacacgtagaccttactatt
ttaggcgctatggaagtttctgaaaacggagatattgccaactggaaaatacctggaaaa
atggtaaaaggtatgggtggggcaatggacttagttgcatctgcagaaaatattattgtt
gctatgatgcacaccaacagagcaggagagtctaaattattagacaaatgtaccttacct
ttaactggtgttggttgtgtaaaaaaaatagtaacaaacctagctgttttagaggttact
aaagaagggtttttacttttagagcgcgccccaggtgtaactgtagatgaaataaagaaa
gccacaaagggtactttaattgtagatggagacgttcctgaaatggatatttaa

DBGET integrated database retrieval system