KEGG   Cellulophaga lytica HI1: IX49_16375Help
Entry
IX49_16375        CDS       T03279                                 

Definition
(GenBank) flavin reductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
clh  Cellulophaga lytica HI1
Pathway
clh00633  Nitrotoluene degradation
clh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:clh00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    IX49_16375
Enzymes [BR:clh01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     IX49_16375
  1.-  
   1.-.-  
    1.-.-.-  
     IX49_16375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase Ham1p_like
Motif
Other DBs
NCBI-ProteinID: AIM62018
Position
3672678..3673325
Genome map
AA seq 215 aa AA seqDB search
MIEDLSNRYTSKAYDKTKRVSAEDLATIEEVLRLSPSSINSQPWKFIVIKSDEAKQRLAK
TFEKYKFNQPHATNASEIILFANKVHYSKEDFKKRLDASMAAGRMNQKGYDKMLTNAFKF
AEMTADENGNNSHWTKAQSYIALGNVLHTLARLKIDSTPMEGVDADEIQKEFAKELGDDY
ECTFALAIGYHNDGKDYNRKLPKARMAKEDVILEL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
attattgaagatttgagcaatcgctatacatcaaaagcatacgataaaacaaaacgcgtt
tcagccgaagatctggcaacaatagaagaagtattacgcttatcgccttcctctataaac
tcacaaccttggaaatttatcgttattaagagtgatgaagcaaaacagcgtctggcaaaa
acttttgagaagtataaatttaatcaaccacacgctacaaacgcttcagaaattattctt
tttgcgaataaagtacattatagcaaagaagattttaaaaaacgtttagacgctagtatg
gctgctgggcgtatgaatcaaaaagggtatgacaaaatgctaacaaatgcatttaaattt
gctgaaatgacagccgatgaaaacggaaacaatagtcattggacaaaagcgcaatcttac
attgctttgggtaacgtactgcacacattggcacgcttaaaaatcgattctacaccaatg
gaaggtgtagatgcggatgaaattcaaaaagaatttgccaaagaattaggagatgattac
gaatgtacttttgctttagcaattggttatcacaacgatggaaaagattacaaccgtaaa
ttgcctaaagcacgaatggcaaaagaagatgtaattcttgaactttaa

DBGET integrated database retrieval system