KEGG   Cellulophaga lytica HI1: IX49_16690Help
Entry
IX49_16690        CDS       T03279                                 

Definition
(GenBank) haloacid dehalogenase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
clh  Cellulophaga lytica HI1
Pathway
clh00010  Glycolysis / Gluconeogenesis
clh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:clh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IX49_16690
Enzymes [BR:clh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     IX49_16690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like XkdW
Motif
Other DBs
NCBI-ProteinID: AIM62078
Position
3747633..3748235
Genome map
AA seq 200 aa AA seqDB search
MIKNIIFDFGDIFINLNKTATALELSKFGFTKITPELDVLMKNYEKGLISSDDFINKTNK
IFPTATPQELKNAWNKIILDFPEERLLFIETLAKEKNYRLFLLSNTNELHIEQVIKNMGT
ERYDRFKACFEQFYLSHLINFRKPNANIYEFVLKENNLNTKETFFIDDTEENTIAAEKLG
IKSWNLQVGNEDIINLKSKL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaatataatttttgattttggcgatatttttataaacctaaacaaaacagct
accgcattagaattaagtaaatttggctttaccaaaattacccctgagttagacgtatta
atgaagaattatgaaaaggggttaatttcttctgatgattttataaataaaacaaacaaa
atttttcctactgccacaccacaagaacttaaaaatgcttggaataaaattattttagat
ttccctgaagaacgtttactatttatagaaacattagctaaagagaaaaattaccgttta
tttttgcttagcaatacaaatgaattacatatagagcaggttattaaaaatatgggaact
gaaagatatgatagatttaaagcttgttttgagcaattttacttatcccatttaattaat
tttaggaaacctaatgctaatatttacgagtttgtattaaaagaaaacaacttaaatact
aaagaaactttttttattgatgacacagaagaaaatacaattgctgcagaaaaattagga
attaaaagctggaatttgcaagttggcaatgaagacatcatcaacctaaagagtaaatta
tag

DBGET integrated database retrieval system