KEGG   Chlorobium limicola: Clim_0452Help
Entry
Clim_0452         CDS       T00766                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cli  Chlorobium limicola
Pathway
cli00010  Glycolysis / Gluconeogenesis
cli00030  Pentose phosphate pathway
cli00051  Fructose and mannose metabolism
cli00052  Galactose metabolism
cli00680  Methane metabolism
cli01100  Metabolic pathways
cli01110  Biosynthesis of secondary metabolites
cli01120  Microbial metabolism in diverse environments
cli01130  Biosynthesis of antibiotics
cli01200  Carbon metabolism
cli01230  Biosynthesis of amino acids
cli03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:cli00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clim_0452
   00030 Pentose phosphate pathway
    Clim_0452
   00051 Fructose and mannose metabolism
    Clim_0452
   00052 Galactose metabolism
    Clim_0452
  Energy metabolism
   00680 Methane metabolism
    Clim_0452
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Clim_0452
Enzymes [BR:cli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Clim_0452
Protein phosphatases and associated proteins [BR:cli01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Clim_0452
Messenger RNA biogenesis [BR:cli03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Clim_0452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ACD89545
UniProt: B3EG12
Position
512845..513864
Genome map
AA seq 339 aa AA seqDB search
MTDKNNVPNVSQKRVKLRRIGVFTSGGDAPGMNAAIRAVTRAAIANKLKVVGIRRGYQGM
IEGDFIPLKSADVSGIIQLGGTILKTARSAEFRTPEGREKAWLQLQKADIDAVVVIGGDG
SFTGALTMSQEYNISFVGIPGTIDNDMYGTDYTIGYETALNTVVCAVDKIRDTAVSHGRI
FLVEVMGREAGLLALNSGIACGAEVILIPESKEQHDELKRFLDKGYKNKERSGIVIVAEG
DEPGGALKIAEAVGRDHPDLDVRVSILGHIQRGGSPTANDRINATRMGIAAVDALLDDQK
SVMIGLDNGKIVQVPFNKAVKLNHSIDTGLLDIQKMLSM
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgacagataaaaataacgtaccgaacgtttctcagaagagagtgaagttacgcaggatc
ggcgtgtttacttccggtggggatgctccgggcatgaatgcggctatcagggcggtgacc
cgtgcggctattgcgaacaaactgaaagtggtcggcatccgccgcgggtatcaggggatg
atagagggagatttcattccgctgaagtcggcagatgtcagcggtattatccagttgggc
gggacgattctaaaaacggcacgcagcgccgaattcagaactcccgaaggccgcgaaaaa
gcctggctgcagttgcagaaagccgacatcgacgcggttgtggtgatcggaggcgacggt
tcctttaccggagcgctgacgatgtcgcaggagtacaacatctcgtttgtaggcatcccg
ggtaccatcgataacgatatgtacggcacggattataccatcggttatgaaacggcgttg
aataccgtcgtgtgcgccgtcgataaaataagggatacggcagtatcgcacggcaggatt
tttctggtcgaggtcatgggccgcgaagccggtctgcttgctctgaacagcgggatagcc
tgcggggcagaggtgattctgattcctgaatcgaaggaacagcacgacgagctgaagcgg
tttctcgataaggggtataaaaacaaggagagaagcgggatcgttattgttgccgaaggg
gatgagcccggaggtgcgctgaaaatagccgaagcggtcggcagggatcatcccgacctt
gatgtgcgggtttccattcttggccatatacagcgaggggggagtccgacggccaacgac
cggataaacgcaacgaggatgggcatagcggcagtcgatgctttgctcgacgatcagaag
agcgtcatgatcggacttgataatggaaaaatcgtacaggtgccgttcaataaagccgtg
aaactgaatcacagcatcgataccggtctgctcgatatacagaagatgctcagtatgtag

DBGET integrated database retrieval system