KEGG   Chlorobium limicola: Clim_0597Help
Entry
Clim_0597         CDS       T00766                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cli  Chlorobium limicola
Pathway
cli00010  Glycolysis / Gluconeogenesis
cli00620  Pyruvate metabolism
cli00640  Propanoate metabolism
cli00680  Methane metabolism
cli00720  Carbon fixation pathways in prokaryotes
cli01100  Metabolic pathways
cli01110  Biosynthesis of secondary metabolites
cli01120  Microbial metabolism in diverse environments
cli01130  Biosynthesis of antibiotics
cli01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cli00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clim_0597
   00620 Pyruvate metabolism
    Clim_0597
   00640 Propanoate metabolism
    Clim_0597
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Clim_0597
   00680 Methane metabolism
    Clim_0597
Enzymes [BR:cli01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Clim_0597
Lipid biosynthesis proteins [BR:cli01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Clim_0597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACD89684
UniProt: B3EH04
Position
complement(665478..667451)
Genome map
AA seq 657 aa AA seqDB search
MATEENASTNQQSISSVLSEKRKFPPPEQFSQSAHISSMEEYEKLYAAAAEDPEAYWGGI
AEQFHWFKKWDSILEWNTPYAKWFNGGKTNICYNAVDVHMQSWRKNKAAIIWEGEEGNQQ
VITYGELHRQVSKFANVLKIAGIQPGDRVAIYMGMVPELVIAVLACARVGAVHNVIFAGF
SAHAITERVNDSRAKLVICCDGTRRRGSSINLKKIVDEAIVNTPSVRSVIVLKVTGETVS
MHDGMDHWWHDLMGLAMDVCEPVHVESEHPLFVLYTSGSTGKPKGILHTTAGYMVHAASS
FRYVFDIKDEDIYWCTADVGWITGHSYMVYGPLLNGATLLMYEGAPNYPQWDRFWDIINR
HKVTILYTAPTAIRAFIRAGNEWVTKHDISSLRLLGTVGEPINPEAWMWYHKIVGQEKCP
IVDTWWQTETGGIMVSPLPGATPTKPGTATRPLPGIMVDVVRKDGTPCEANEGGYLVIKK
PWPSMLRTIYGDNERYEKTYWSEFDDMYFTGDGARKDEDGYIWIMGRVDDVVNVSGHRLG
TSEVESALVSHEAVAEAAVVSRPDDIKGNALVAFVTLKDEYEGDMKLRESLRNHVAKEIG
PIAKPDEIRWAKGLPKTRSGKIMRRLLRELATSNEIKGDITTLEDFGVLENLRDQED
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atggctacagaagaaaacgcatcaaccaatcagcaatcaatcagttctgtcctctcggaa
aaacgaaaatttccgcctccggagcaattttcgcaatccgctcacatctcctcgatggaa
gagtacgagaagctttatgccgcggcagctgaagaccccgaagcttactggggtggaatt
gcagaacagtttcattggttcaaaaaatgggatagcatactggaatggaataccccgtat
gcaaagtggttcaacggcggtaaaacgaacatatgctacaatgccgtcgatgttcacatg
cagagctggagaaagaacaaggccgccattatctgggaaggtgaagaaggaaatcagcag
gtcatcacatacggcgaactgcatcgccaggtcagcaaattcgccaatgtactgaaaatc
gccggcattcagccgggtgatcgcgtagccatctacatgggtatggttcccgaactggtt
attgccgttcttgcctgtgcccgtgtaggcgctgtccacaacgttattttcgcaggattt
tcagctcatgccattaccgaaagagtcaacgactcccgggcaaaactggtcatctgctgc
gacggcacaagacgccggggaagctcgatcaacctgaaaaaaattgttgacgaagccatc
gtcaacaccccttccgtccggagcgtaatcgtcctgaaggtcaccggcgaaaccgtcagc
atgcacgacggaatggaccattggtggcacgatctcatgggtcttgccatggatgtctgc
gagccggtacatgttgaatcagaacatccgctcttcgtgctctacaccagcggatccacc
ggcaagccgaaaggcattctgcacacgacggcaggttacatggtacatgccgcaagctct
ttcagatatgtgttcgacatcaaggatgaggacatctactggtgtaccgccgatgtaggc
tggatcaccggtcacagctacatggtttacggtccgctcctcaacggcgctaccctgctc
atgtacgaaggcgcgcccaactatccgcagtgggaccgcttctgggatatcatcaaccgt
cacaaggttaccattctctataccgctcctaccgctatccgcgcattcatccgagccggc
aacgagtgggttaccaaacacgatatcagctcgcttcgcctgctcggcacggttggcgaa
ccgataaatcccgaagcatggatgtggtaccacaaaatcgtcggtcaggaaaaatgtccg
atcgtcgacacctggtggcagaccgaaacaggcggcatcatggtctccccgcttcccggt
gcaaccccgacaaaacccggcacggctacccgcccgcttcccggcatcatggtcgatgtc
gtgcgcaaggacggcacaccgtgcgaagccaacgaaggcggatacctggtcatcaaaaaa
ccatggccgtcaatgctcagaaccatctatggcgataacgaacggtacgaaaaaacctac
tggtctgaattcgacgacatgtacttcaccggtgacggcgcacgcaaggacgaagacggt
tacatctggatcatgggccgcgtcgatgacgttgtcaacgtctccggacaccgcctcggc
accagcgaagtcgaaagcgccctcgtatcccacgaagccgttgcagaggcagctgtcgtc
agccgtcccgacgacatcaagggcaatgcgcttgtggccttcgtcacgctcaaggacgag
tatgaaggcgacatgaagcttcgcgaatcgctccgcaaccacgttgccaaggagatcggc
ccgatcgccaaaccggatgagatccgctgggcgaaaggtcttccgaaaacccgcagcggc
aaaatcatgcgcaggctgctacgcgaacttgcaaccagcaacgaaatcaagggcgatatc
acaacgctcgaagatttcggcgtactggagaacctccgcgaccaggaagactga

DBGET integrated database retrieval system