KEGG   Chlorobium limicola: Clim_1780Help
Entry
Clim_1780         CDS       T00766                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
cli  Chlorobium limicola
Pathway
cli00521  Streptomycin biosynthesis
cli00523  Polyketide sugar unit biosynthesis
cli01130  Biosynthesis of antibiotics
Module
cli_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:cli00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Clim_1780
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Clim_1780
Enzymes [BR:cli01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Clim_1780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ACD90819
UniProt: B3EEK9
Position
complement(1957520..1958098)
Genome map
AA seq 192 aa AA seqDB search
MNIIESAIPDVLIIEPKVFGDERGYFLETYRQDVIESRIGKVGFVQDNESKSSYGVLRGL
HYQKPPFTQSKLVRAVSGSVLDIAVDLRKGSPWFGKYVGVELSAERKNMLWIPKGFAHGF
VVLSTEAVFAYKCDNYYAPDHDAGVLWNDRELAIDWQIPESDIRVSDKDAKQQLFAEVDC
FIYDEFKRETLY
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaacattatagaaagtgccattcccgatgtcctgatcattgaaccgaaagttttcggc
gacgaacggggttattttcttgaaacgtaccggcaggatgtaatagaatcgcgtatcgga
aaggtagggttcgtgcaggataacgagtcgaaatcgtcgtatggcgttttgcgtggactg
cattaccagaagcctccatttacccagtcaaagctggtcagggcggtttcgggaagcgtg
ctcgatatagctgtcgatctgcggaaaggttcgccatggttcggaaagtatgtcggtgtc
gagttgagtgcggagcgtaagaatatgctgtggattccgaaagggttcgctcatggtttc
gtggtgctttcgacagaggcggtattcgcttataaatgtgataactattatgctcccgat
catgatgccggagtgctctggaacgatcgcgaacttgcaattgactggcagattccggaa
tcggacatcagggtgtcggataaagatgcgaaacagcaattatttgcagaggtcgattgc
tttatctatgacgagttcaaaagggagacactgtactga

DBGET integrated database retrieval system