KEGG   Chlorobium limicola: Clim_1938Help
Entry
Clim_1938         CDS       T00766                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cli  Chlorobium limicola
Pathway
cli00010  Glycolysis / Gluconeogenesis
cli00260  Glycine, serine and threonine metabolism
cli00680  Methane metabolism
cli01100  Metabolic pathways
cli01110  Biosynthesis of secondary metabolites
cli01120  Microbial metabolism in diverse environments
cli01130  Biosynthesis of antibiotics
cli01200  Carbon metabolism
cli01230  Biosynthesis of amino acids
Module
cli_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cli00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clim_1938
  Energy metabolism
   00680 Methane metabolism
    Clim_1938
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Clim_1938
Enzymes [BR:cli01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Clim_1938
Membrane trafficking [BR:cli04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Clim_1938
Exosome [BR:cli04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Clim_1938
  Exosomal proteins of melanoma cells
   Clim_1938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACD90970
UniProt: B3EFK8
Position
complement(2148931..2149674)
Genome map
AA seq 247 aa AA seqDB search
MIKLVLLRHGESQWNLENRFTGWHDIDLTDNGRIEASNAGRAIKEAGLTFDIAYTSVLKR
AIRTLWNALDVLDLMWIPVVKSWRLNERHYGALQGLNKSETSRKYGEEQVLVWRRSYDTP
PPVLDKDDERYPGTDRRYAELGEAEIPLSECLKDTVERFLPIWRDTIEPEIRKGRKVLIV
AHGNSLRALVKYLDNISEEDIVGLNIPTGIPLVYELDDDLKPLKSYYLGDQEAIKQAVQA
VAGQAKA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacttgttttattgcgccatggcgaaagccagtggaatctggaaaaccgtttt
accggctggcatgacatcgatctgacggataacggtagaatcgaggcttcaaacgcaggg
cgggcaataaaagaggctggcctgacctttgatatagcctatacctcggttctgaagaga
gccataaggactctctggaacgcccttgacgttctggatctcatgtggataccggtcgtc
aaaagctggaggctcaatgagcgtcattacggtgcgctgcaggggttgaacaaatccgaa
acatcccgcaaatacggtgaggagcaggtacttgtctggagaagaagctatgatacgccg
cctcccgtactcgataaggatgacgaacgttatcccggcaccgatcggcggtatgcggaa
ctgggtgaagctgaaattccgctttccgagtgccttaaagacaccgtggagcgttttctc
ccgatctggcgcgataccatcgagcctgaaatccgtaaaggcagaaaggtgcttattgtc
gctcacggcaattcgcttcgtgcgctggtcaaatacctcgacaacatttccgaagaggat
attgtcggcctgaacatcccgacaggaattcctctggtctatgaacttgacgacgatctc
aaaccgctgaaaagttattatctgggcgatcaggaggcgataaaacaggcggtacaggcc
gttgccggacaggcgaaagcatag

DBGET integrated database retrieval system