KEGG   Chlorobium limicola: Clim_2124Help
Entry
Clim_2124         CDS       T00766                                 

Definition
(GenBank) ribosomal protein S21
  KO
K02970  small subunit ribosomal protein S21
Organism
cli  Chlorobium limicola
Pathway
cli03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cli00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Clim_2124
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cli03011]
    Clim_2124
Ribosome [BR:cli03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    Clim_2124
  Bacteria
    Clim_2124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S21
Motif
Other DBs
NCBI-ProteinID: ACD91148
UniProt: B3EGN5
Position
complement(2344537..2344734)
Genome map
AA seq 65 aa AA seqDB search
MVSVQINDNESIDKMLKRFKKKYERAGVLKEFRKRAYFVKPSVDSRLKRSRCKRRAQRAN
EESNS
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
ttggttagtgtgcagattaatgataacgagtccatcgacaagatgctgaagcgcttcaaa
aagaaatatgagagagctggcgtgttgaaggagttccgaaagagagcatactttgtcaaa
ccgtcagtggacagccgtctgaaacgttcgagatgcaagcgaagagctcagagagcgaat
gaagagagcaattcctga

DBGET integrated database retrieval system