KEGG   Chlorobium limicola: Clim_2165Help
Entry
Clim_2165         CDS       T00766                                 

Definition
(GenBank) HAD-superfamily hydrolase, subfamily IA, variant 3
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
cli  Chlorobium limicola
Pathway
cli00010  Glycolysis / Gluconeogenesis
cli01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clim_2165
Enzymes [BR:cli01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     Clim_2165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NIF
Motif
Other DBs
NCBI-ProteinID: ACD91189
UniProt: B3EGS6
Position
complement(2403508..2404098)
Genome map
AA seq 196 aa AA seqDB search
MSVVLLDIGNVLVDVDFTVFCRKVSRHGENGAEELYGRYCVSEFKDLFDKGAIAPIDYLE
TIAGDPETRPMTIRELKTAWQDIFSPKNEAPESVREMMLSHTVWIMSDTDPLHFTALLNN
VPVLRTAERYWLSFEHGYLKREPGAFHEVLSCSGQNAKQFVLIDDREDNCQCAESCGIKA
VHFRDWSQALQELQDL
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcgttcttcttgatatcggcaatgtgctggtcgatgtcgatttcacggttttc
tgcaggaaggtatcacggcatggcgaaaacggagcggaggaactctatggccggtattgc
gtgagtgagttcaaagatctgttcgataaaggcgcgatcgctccgatcgactatcttgaa
acgattgccggcgatccggaaacccgacccatgacgatccgggagctgaaaacggcatgg
caggatattttttcccctaaaaacgaggctccggagtcggtgcgtgagatgatgctgagc
catacggtctggatcatgagcgacaccgacccgctccattttaccgcacttctcaataat
gtgccggtattgagaacagccgaacgttactggctctcttttgaacacggttatctcaag
agggaaccgggtgcgtttcatgaggtgctttcctgttccggacagaacgcaaaacagttc
gtgctgatcgatgaccgcgaagataactgccagtgcgccgaatcatgcggcatcaaggca
gttcatttcagggactggagtcaggcgcttcaggagctgcaggatttataa

DBGET integrated database retrieval system