KEGG   Chlorobium limicola: Clim_2504Help
Entry
Clim_2504         CDS       T00766                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine/D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
cli  Chlorobium limicola
Pathway
cli00471  D-Glutamine and D-glutamate metabolism
cli00550  Peptidoglycan biosynthesis
cli01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cli00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Clim_2504
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Clim_2504
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cli01011]
    Clim_2504
Enzymes [BR:cli01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     Clim_2504
Peptidoglycan biosynthesis and degradation proteins [BR:cli01011]
 Precursor biosynthesis
  Amino acid ligase
   Clim_2504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: ACD91522
UniProt: B3EIL0
Position
complement(2742903..2744300)
Genome map
AA seq 465 aa AA seqDB search
MDVHGKKASIIGAKRSGVAAAELLAKSGAKVFVSELGEPGASEAERLADCGIPWEQDGHT
DRVCDADFCVVSPGIPRTAGIIRRVLEQGIPLYSEIEAASWFCKARIAGITGTDGKTTTS
TLLHRIAEADGMKNDYRAFSVGNIGVPFSSLVLDMAPADLAVVELSSYQLEGCETFRPDV
SVITNITPDHLDRYNGDMQLYAAAKFRIYASQRASDTLVYNFDDPLLRAQFSGNGRGFPF
RIVPFGIGNDVPGSGSEEAFFYDEGMIRHLTAKGISEVFSGEDFLKSSFRGRHNIYNALA
ALAAAAALGIEESVARKAISGFSGVEHRQEFVCSLDGVEWINDSKATNVNALLQALDAVP
GSIVLIAGGRDKGNDYTVLFDVVRRKVVTVIAIGEAREKILQVFEGITRTAGADTLDDAV
ALARESAEKGQTVLFSPGCASFDMFENFEERGRLFKRSILALNPC
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggatgtacatggcaaaaaagcatcgattatcggtgcaaaacggagcggtgtcgctgca
gcggaattgcttgcaaagagcggcgcaaaggtgttcgtgagcgaacttggtgagccggga
gcttccgaagcggagcgtcttgccgattgtggcattccctgggagcaggatgggcatacc
gacagggtttgcgatgcggatttttgtgtcgtcagtccaggcattccccgaacagcagga
attatccggcgggtccttgaacagggcattcctctttacagtgagatcgaggccgcgagc
tggttctgcaaggcaagaattgcaggtattaccggaacggacggcaagaccaccacgtcc
acgcttctgcaccgcatagctgaagccgatggcatgaaaaacgactacagggctttcagc
gtcggaaacatcggtgtgccgttttcttctctggtgctggatatggctcccgctgatctt
gcggttgtcgagttgagcagttatcagcttgaaggctgtgaaaccttcaggccggatgtt
tcggttatcacgaacatcactcccgatcatctcgatcgttataacggcgatatgcagttg
tatgccgcagcaaaattcaggatttacgcttcacagcgcgcctcggatactctggtgtac
aattttgacgacccgttgctccgggctcaattcagcggaaatggcaggggatttcctttt
cgtatcgttccgttcggcatcggtaacgatgtgcccggatccggttcggaggaggcattc
ttttatgacgaagggatgattcggcatttgaccgcaaaagggatttcggaggttttttcg
ggggaggattttctgaaaagcagtttcaggggccgtcataacatctataatgcccttgct
gcgcttgctgcggccgcagcgctcggcattgaagagagcgttgcccgcaaggcgatttca
gggttttccggcgttgagcatcgacaggagttcgtgtgctctcttgacggagtcgaatgg
atcaatgattcgaaggcaaccaatgtcaatgcgcttctgcaggcgctcgatgccgttccg
ggcagtattgttctgattgcgggaggaagggataaagggaacgattatacggttcttttc
gatgtcgttcggcggaaagtagtgacggtgattgccataggagaagcaagagaaaagatt
ttacaggtatttgaggggataacccgtactgcaggagctgatactctcgatgacgcggta
gctctcgcacgggaatctgccgaaaaaggccagacggtgcttttttctcccggctgtgcc
agtttcgatatgtttgagaattttgaagaacgggggcgacttttcaagcgctctattctt
gctttgaacccatgttga

DBGET integrated database retrieval system