KEGG   Clostridium ljungdahlii: CLJU_c16120Help
Entry
CLJU_c16120       CDS       T01276                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
clj  Clostridium ljungdahlii
Pathway
clj00260  Glycine, serine and threonine metabolism
clj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
clj01100  Metabolic pathways
clj01110  Biosynthesis of secondary metabolites
clj01130  Biosynthesis of antibiotics
clj01230  Biosynthesis of amino acids
Module
clj_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:clj00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLJU_c16120 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CLJU_c16120 (trpB)
Enzymes [BR:clj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CLJU_c16120 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADK14676
UniProt: D8GTM7
Position
1751164..1752339
Genome map
AA seq 391 aa AA seqDB search
MDGRFGKFGGQYVPETIMNAVMQLEKEFNKAIKDEKFIEEYKYYLKDYVGRENPLYFAKN
FTEKLGGAKIYLKREDLNHTGAHKINNALGQVLLARRMGKKRVIAETGAGQHGVATATAA
AIFGMECEVFMGEEDIRRQALNVFKMKILGSKVTSVTSGTGTLKDAVNEAMRNWVSNIED
TFYVIGSVMGPHPYPTMVRDFQRVIGDEARKQILEKEGRLPDYVIACVGGGSNSMGIFYP
FVEDTSVNLVGVEAAGKGLDTDEHAATISKGSVGVIHGMMTYVLQDEDGQILPAYSISAG
LDYPGIGPEHAYYHDIKRATYESATDKEAVNAFTYLSQVEGIIPALESSHALAYAMKLAP
KLSKDKIIIVNLSGRGDKDINTIANIMGVEL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggatggaagatttggaaaatttggaggacagtatgtaccagaaacaataatgaatgca
gttatgcagcttgaaaaggagtttaataaagcaataaaagatgaaaaatttatagaggaa
tataagtactatcttaaagattatgtgggaagagaaaatccactgtattttgcaaagaat
tttactgaaaaattaggtggagcaaaaatatatcttaaaagagaagacttaaaccatacg
ggagcacataaaataaacaacgcactaggacaggtgctccttgcaaggagaatgggtaaa
aaaagggttatagctgaaacaggagctggacagcatggggtagctacagctacggcagct
gctatctttggaatggaatgtgaagtatttatgggtgaagaagacataagaagacaagct
cttaatgtatttaagatgaaaatattaggttctaaagttacttctgtaacttcggggacg
ggaacacttaaagatgctgtaaatgaagctatgagaaattgggtatcgaatatagaagat
accttttatgtaataggctctgtaatgggaccgcatccttatccaactatggttagagat
tttcaaagagtaattggagatgaagctagaaagcaaattctggaaaaggaagggagactt
cctgattatgtcatagcttgtgtaggcggtggaagcaattccatgggaattttttatccc
tttgtagaagatacttctgtaaatttggtaggagtagaggccgcaggaaaaggacttgat
acggatgaacatgcagctactatatcaaaggggtctgtaggagtaattcatggtatgatg
acttatgtgcttcaagatgaggatggtcaaatacttcctgcgtattctatatcagcagga
cttgattatccgggaataggacctgaacacgcatattatcatgatataaagagagcaact
tatgaatcagctacagataaggaagcagtcaatgcatttacttacttgtcacaggttgag
ggaataattccagcacttgaaagctctcatgccctagcttatgcaatgaagcttgctcca
aaactcagtaaggataaaataatcattgtaaatttatctggaagaggggacaaagatata
aatactatagctaatataatgggggtggaactataa

DBGET integrated database retrieval system