KEGG   Clostridium ljungdahlii: CLJU_c25810Help
Entry
CLJU_c25810       CDS       T01276                                 

Definition
(GenBank) zinc-containing alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
clj  Clostridium ljungdahlii
Pathway
clj00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:clj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CLJU_c25810
Enzymes [BR:clj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     CLJU_c25810
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     CLJU_c25810
    1.1.1.-  
     CLJU_c25810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C ThiF Nucleoplasmin Gp_dh_N NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: ADK15639
UniProt: D8GM65
Position
complement(2858346..2859362)
Genome map
AA seq 338 aa AA seqDB search
MEKMKQVWFTDKNKVEVRNVEIPKVAENQVKVKIAYAALCATDVHMVTMGVLGAKPPMRL
GHEASGIIEELGEGADKFGFKIGDKVSLFPVTSCGKCPACKKGQPQYCHNSQDTGAFAEY
VVTDVSAVFKIPDDADLQWYSLVEPANCTVRAMDLAQIKHGDTVAISGVGGIGSILLNMI
LLAGGAKVTAIDPVESKRQMALNMGAQYVIDPFNENMEKRAMEITDGNGFDYVFEASGSP
KAAEPALKIMGKCGTVVYFAVFPPKYEMPLNLYELYMKEGRIQTVFTTTSIMPRTINLIP
RLQLDKVIGKVMPLSDAVKGFELFNKSIYPKILFDCSK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaaatgaaacaggtatggtttacagataaaaataaagtagaagttcgtaatgta
gaaattccaaaggtagctgagaatcaggtaaaggtaaaaattgcatatgctgctctttgt
gcaacagacgtgcatatggtaaccatgggggtattaggtgcaaaaccgccaatgcgtctt
ggtcatgaagcatctggtatcattgaagagttaggcgaaggagctgacaagtttggattt
aaaattggtgataaggtttctctttttccagtaacaagttgtggaaagtgtccagcctgc
aaaaaaggacagccccaatattgtcataattctcaagacacaggtgcttttgcagaatac
gtggtgactgatgtcagtgctgttttcaagattccagatgatgctgatttacaatggtat
agtttagtagaaccagcaaattgtactgtccgtgctatggatttagcgcaaataaagcat
ggtgatacggttgcaatttcaggcgtaggtggtattggttctattcttttaaatatgatt
ttacttgcaggtggtgcaaaggtaactgctattgatcctgtagaatctaaacgtcaaatg
gcacttaacatgggagcacagtatgtgattgacccattcaatgaaaatatggaaaagcgt
gcaatggaaattacagatggtaatggctttgattacgtatttgaggcatcaggttctcct
aaagcggcagaaccagcactaaaaattatgggcaaatgtggtacagtagtttactttgca
gtatttccccctaaatatgaaatgccactgaatctctatgaactatatatgaaggaaggt
aggattcaaacagtatttactacaacttcaattatgcctcgtaccatcaatcttatccca
agattacagcttgataaggttattggcaaggtaatgccactgagtgatgcagtgaaaggg
tttgaactgtttaataaatcaatttatcctaaaattttatttgattgctctaaataa

DBGET integrated database retrieval system