KEGG   Clostridium ljungdahlii: CLJU_c28100Help
Entry
CLJU_c28100       CDS       T01276                                 

Definition
(GenBank) D-galactarate dehydratase
  KO
K01708  galactarate dehydratase [EC:4.2.1.42]
Organism
clj  Clostridium ljungdahlii
Pathway
clj00053  Ascorbate and aldarate metabolism
clj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    CLJU_c28100
Enzymes [BR:clj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.42  galactarate dehydratase
     CLJU_c28100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GD_AH_C
Motif
Other DBs
NCBI-ProteinID: ADK15864
UniProt: D8GNK1
Position
complement(3109217..3110740)
Genome map
AA seq 507 aa AA seqDB search
MDSNQLKPLYIKVNPEDNVAIIVNKDGLKKGITFENGLKLLQDIPQANKVLLKDISKDEP
FIRYGEIIGFAKKNLKKGSRVAHDEVRLPKAHSLNELKSGKMIDKYEPLQGYTFMGYKNE
DGSVGTKNILGITTTVQCVQGVVNVAVERIKNELLPKYKNVDAVVALNHLYGCGVAIHGD
NSEIPIRAIRNLSQNPNFGGEMLTVSLGCEKLVPTLLFPEIKDENLVILQECFGFNKMID
EIMKRAEKKLKKLNSRVRTKCPVSDLVVGLQCGGSDAFSGVTANPAVGFAADLLVRSGAK
VMFSEVTEIRDAVHLLAPRTVSDEVLAKLVKEMKWYDKYLDESHVDRDANPSPGNKKGGL
LNVVDKALGSVAKSGSTSIVDVLSPGERIRKRGMTYAATPASDFVCGTMQLSSGMTLQVF
TTGRGTTYNLMIAPVIKVSTNTALKEKWNDLIDLDAGRIATGEKTIEEVGLELFKLIIDI
ASGTKKTYADVHGIYNALSIFNPAPIT
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggatagtaatcaattaaaacctttgtatattaaagttaaccctgaagacaatgtagct
ataatagtaaacaaagatggacttaaaaagggaattacttttgaaaatggattgaaattg
ctgcaggatataccgcaagctaataaagtgcttttaaaagatatttcaaaggatgaacct
tttattaggtatggagaaataattggatttgcaaaaaaaaatttaaaaaagggaagtcgg
gtagcacacgatgaagttagactacctaaggcacattcattaaatgaattaaaaagcggt
aaaatgattgataaatatgaacctttacaaggttacacatttatgggatataaaaatgaa
gatggcagcgttggaactaaaaatatacttggaataactacaacagttcaatgtgtacaa
ggtgttgtcaatgttgcagtagagagaatcaaaaatgagcttttacctaagtataaaaat
gttgatgctgttgtggctttgaatcatctatatggatgtggtgttgcaatacatggtgat
aattctgaaattcctataagggcaataagaaatttatcccagaatcctaattttggtggt
gaaatgctgacagtatctcttggatgcgaaaaattagtacctacattactttttcctgaa
ataaaagatgaaaatcttgtaatactacaggaatgttttggatttaataaaatgattgat
gaaattatgaaaagagcagaaaaaaaacttaaaaagttaaattcaagagttagaaccaaa
tgtcctgtatctgatttagtagttggacttcagtgcggtggaagtgatgctttttcagga
gttacggcaaacccagcagtaggatttgcagcagatttattagttagatcaggtgcaaag
gtaatgttttctgaagtgactgaaattagagatgcagttcatttgctggcacctagaaca
gttagtgatgaagtacttgcgaaacttgttaaggaaatgaaatggtatgataaatatttg
gacgaatcacatgttgatagagatgcaaacccttcaccaggaaataaaaaaggtggcctt
ttaaatgttgtagataaagcacttggatcggtagctaaatcaggtagtacaagcatagtg
gatgtattatctccaggagagcgtattagaaaaagaggtatgacctatgctgcaacacca
gcaagcgattttgtttgtgggacaatgcagttatcatcaggtatgactttacaagtgttt
actactggaagaggtactacatataatttaatgattgcccctgttataaaagtttcaact
aatacagcacttaaagaaaaatggaatgatttaatagatctagatgcaggaagaattgcc
acaggtgaaaagacaattgaagaggttggtttagaactttttaaattgataatagatata
gctagtggaactaaaaaaacttatgcagatgtacatggaatttataatgcattatcaatt
tttaatcctgcaccaattacatga

DBGET integrated database retrieval system