KEGG   Campylobacter lari subsp. concheus LMG 11760: CONCH_0078Help
Entry
CONCH_0078        CDS       T03557                                 

Gene name
murI
Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
cll  Campylobacter lari subsp. concheus LMG 11760
Pathway
cll00471  D-Glutamine and D-glutamate metabolism
cll01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cll00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CONCH_0078 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cll01011]
    CONCH_0078 (murI)
Enzymes [BR:cll01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     CONCH_0078 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:cll01011]
 Precursor biosynthesis
  Racemase
   CONCH_0078 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AJC88529
UniProt: A0A0A8H6M2
Position
63786..64526
Genome map
AA seq 246 aa AA seqDB search
MRLGVFDSGVGGLSVLKSLLQAKLFKEYIYYGDTARVPYGVKDKETIVKFSLEALEFFKE
KKVDMLIIACNTVSAHALEILKTNAPFPVLGVIEAGVLAVKNSLEDKNSNILVIATQATV
DSHAYKQALIKEGFLKVEEKATGLFVPMVEEGIFQGDFLKAAFEYYFNKLKFHPNALILA
CTHFPLIAHSLSEYFGKNTKLIHSGEAIALQLQQEFNLTSIQEEANIEFYASSDVEKLKK
IANLWL
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagactaggcgtttttgatagtggtgtaggtgggcttagtgttttaaaatctttactt
caagcaaaactttttaaagaatatatttactatggggatactgcaagagtgccttatggg
gttaaagataaagaaactatcgttaaattttccctagaagctttagaatttttcaaagaa
aaaaaagtcgatatgcttattattgcatgtaatacagttagtgcgcatgcattagaaatt
ctaaaaacaaatgcaccatttccggttcttggagttatagaagcaggagttttagcggtt
aaaaactctttagaagataaaaactctaatatattagtcattgcaacacaagctaccgtg
gattctcacgcttataaacaagctttaattaaagaaggttttttaaaagtagaagaaaaa
gcaactgggctttttgtgcctatggttgaagaagggatttttcaaggagattttttaaaa
gctgcttttgaatattattttaataagctcaaatttcatcctaatgctttaattttagca
tgtacacattttcccttaatcgctcattctttgtcagaatattttggtaaaaacacaaaa
cttattcattcgggtgaggctatagctttacaattacagcaagaatttaacttaacatca
atccaagaagaagctaatatcgaattttatgcttcaagtgatgtagaaaaactaaaaaaa
attgcaaatttatggctttaa

DBGET integrated database retrieval system