KEGG   Campylobacter lari subsp. concheus LMG 11760: CONCH_0486Help
Entry
CONCH_0486        CDS       T03557                                 

Gene name
mqo
Definition
(GenBank) malate:quinone-oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
cll  Campylobacter lari subsp. concheus LMG 11760
Pathway
cll00020  Citrate cycle (TCA cycle)
cll00620  Pyruvate metabolism
cll01100  Metabolic pathways
cll01110  Biosynthesis of secondary metabolites
cll01120  Microbial metabolism in diverse environments
cll01130  Biosynthesis of antibiotics
cll01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cll00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CONCH_0486 (mqo)
   00620 Pyruvate metabolism
    CONCH_0486 (mqo)
Enzymes [BR:cll01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     CONCH_0486 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_3 NAD_binding_9 NAD_binding_8 Pyr_redox_2 K_oxygenase 3Beta_HSD HI0933_like Ribosomal_L17
Motif
Other DBs
NCBI-ProteinID: AJC88917
UniProt: A0A0A8H4J6
Position
complement(454312..455658)
Genome map
AA seq 448 aa AA seqDB search
MDQKHFDTVVIGGGISGAAVFYELARYTNIQNIALLEKYNSAATLNSHSTSNSQTIHCGD
IETNYTLEKAKKVKTTADMIVKYGLLQNAQNKFMHSHQKLALAVGDKECEYMKNRYEEFK
ELYPYIKFYTKDKIKQIEPNVVLGEDGVNNRTDEVVAMGVEAGAVYTTVDFGLMSQNLIE
QACKQEKNTHVAYNQEVVFIEKKDDIFYIKTKDFKEYSAKSIIVNAGAHSLFLAHKMGIG
LDKSCFPVAGSFYMSKRKILNGKVYMVQNPKLPFAALHGDPDLLANMNTRFGPTALVIPM
LERYHGFKSLPEFFKTLNLDMNVVKICLNLFKDSTIRNYILYNYLFEIPYINKRLFVKDA
RKIVPSLKTDDIYYAKNFGGVRPQVLDKKAGELMLGEASITEIPGIIFNMTPSPGATSCL
GNGYRDAKLICQYLGANFNEDLFTSELL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaaaacattttgataccgtggtaattggcggtgggatttctggtgctgcagta
ttttatgagctggctagatacacaaatattcaaaatattgctttgttagaaaaatacaat
agcgctgcaactttaaatagccatagcacaagcaattcacaaactatccactgtggtgat
atagagacaaattacactttagaaaaagcaaaaaaagttaaaacaacagcagatatgatt
gtaaaatatggtcttttgcaaaatgcacaaaataagtttatgcactcacaccaaaaactc
gcacttgcagttggagacaaagaatgcgagtatatgaaaaatagatatgaagaatttaaa
gaattatatccttatattaaattttataccaaagataaaatcaagcaaatagagcctaat
gttgtattgggtgaagatggcgtgaataatagaaccgatgaagtagtagctatgggtgta
gaagcaggagcggtttatactacagtagattttggcttgatgagtcaaaatcttatagag
caagcttgcaaacaagaaaaaaatactcatgttgcctacaatcaagaagttgtgtttata
gaaaaaaaagatgatattttttatatcaaaacaaaagattttaaagaatatagtgcgaaa
tctattatagtaaatgcaggagcgcattctttatttttagcgcataaaatgggtatagga
ttagataaatcttgctttccggttgcaggaagtttttatatgtctaaaagaaaaatttta
aatggtaaagtttacatggtgcaaaatccaaaactaccatttgctgcgctacatggcgat
cctgatttattagctaatatgaatacacgctttggccctactgccttagttatccctatg
ttagaaagataccatggttttaaatcactacctgaatttttcaaaacacttaacttagac
atgaatgtagtcaaaatttgccttaatctttttaaagattctactattagaaactatatt
ctttataattatttatttgaaattccttacattaacaaaagactttttgtaaaagatgca
agaaaaatagttcctagtttgaaaacagatgatatatactatgctaaaaattttggtgga
gtacgccctcaagtgcttgataaaaaggcaggagaattaatgcttggagaagcaagtatt
actgaaattccaggtataattttcaacatgaccccaagtccaggtgctacaagttgtctt
ggtaatggctatagagatgcaaaacttatttgtcaatacttgggtgctaattttaatgag
gatttatttactagcgaactactataa

DBGET integrated database retrieval system