KEGG   Campylobacter lari RM16712: UPTC16712_0028Help
Entry
UPTC16712_0028    CDS       T03556                                 

Definition
(GenBank) 23S rRNA pseudouridine synthase, RluD family
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
clm  Campylobacter lari RM16712
Brite
KEGG Orthology (KO) [BR:clm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:clm03009]
    UPTC16712_0028
Enzymes [BR:clm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     UPTC16712_0028
Ribosome biogenesis [BR:clm03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    UPTC16712_0028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: AJD05578
UniProt: A0A0A8I6U7
Position
complement(30157..31062)
Genome map
AA seq 301 aa AA seqDB search
MAYIKKKLSNNGKKAFRLLMDELKISMREAQKLIDKKRLFCNGNLVEEKNKFLDGLVELI
VYENNPKGLEIVYENEDFAVVEKPSGVLTHPNGRNCTYSLCDEIWHLWGEKACVAHRLDK
ETSGLLLIAKHKNAQIELKTMFEKRLVQKSYLALVKGKTKKEFIVDKNMDLAKDYDAVKT
RMQIYKNGKEALTQFYTLEYFENLDASLILAKPLTGRQHQIRLHLFHVKHKILGEPLYGL
EKTQIEQILDGKMSDIERAQITGAKRLLLHSFSLEFTYKNQKFLIQSQKDIKDEFLKEII
Q
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggcatatataaaaaagaaactatcaaataatggaaaaaaggcatttagactgcttatg
gatgagttaaaaatttctatgcgtgaagcacaaaaactcattgacaaaaaaagactattt
tgtaatggaaatttggtagaagaaaaaaacaaatttttagatggcttagtggaattaatc
gtatatgaaaataaccctaaaggattagaaatagtttatgaaaatgaagattttgctgta
gtagaaaaaccaagcggggtgctaactcatcctaatggacgcaattgtacttatagtctt
tgtgatgaaatttggcatttatggggtgaaaaagcttgcgtagctcatagattagataaa
gaaacaagcggacttttactcatagctaaacataaaaatgcacaaattgagttaaaaacc
atgtttgaaaaaagattagtgcaaaaaagctatcttgctctagtaaaaggaaaaactaaa
aaagaatttatagtagataaaaatatggatttagctaaagactatgatgcagtcaaaact
agaatgcaaatttataaaaatggtaaagaagctttaacacaattttacactttagaatat
tttgaaaatttagatgccagtttaattttagctaaacctctaacgggcagacaacaccaa
ataagactacatttgtttcatgtgaaacataaaattttaggtgagcctttatatggttta
gaaaaaacacaaatagagcaaatacttgatggaaaaatgagtgatatcgaaagagctcaa
atcacaggtgctaaaagactgcttttacactcttttagcttagaatttacatataaaaat
caaaaatttttgatacaatctcaaaaagatataaaagatgagtttttaaaggaaataata
caatga

DBGET integrated database retrieval system