KEGG   Campylobacter lari RM16712: UPTC16712_0585Help
Entry
UPTC16712_0585    CDS       T03556                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
clm  Campylobacter lari RM16712
Pathway
clm00860  Porphyrin and chlorophyll metabolism
clm01100  Metabolic pathways
clm01110  Biosynthesis of secondary metabolites
clm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:clm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    UPTC16712_0585 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:clm01007]
    UPTC16712_0585 (hemL)
Enzymes [BR:clm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     UPTC16712_0585 (hemL)
Amino acid related enzymes [BR:clm01007]
 Aminotransferase (transaminase)
  Class III
   UPTC16712_0585 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AJD06104
UniProt: A0A0A8I6U9
Position
complement(559613..560890)
Genome map
AA seq 425 aa AA seqDB search
MKNNKKAFEEACEYIAGGVDSPVRAFASVGSNPLFIKQGKGAYISDIEDNTYIDYVQSWG
PLLFGHCDEDIEKACKKALEHGSSFGAPTLAETKLAKFILKDWPHLDKIRFVSSGTEATM
SAIRLARGFSKKDKIIKFEGCYHGHSDSLLVSAGSGAATFNTPSSLGVLTDVAKNTLVAI
YNDIESVKNLINNDDNIACIIIEPIAGNMGLVPAKIEFLQELRKLCDEHQILLIFDEVMS
GFRASYLGSFGINNIKADIVTFGKVIGGGMPAAAFAARAEIMDLLSPLGGVYQAGTLSGN
PLAMAAGYASLKKARNCEGLYEKLEKLGKRLTQGFKEAANDCKIPLQVNCIGSMFGFFFC
ENPVNNYQDALKSDTKLFAKFHAQMLSKGVYLAPSQFETGFICECMDKKIIDKTIQAAQE
SFKAL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataacaaaaaagcctttgaagaagcttgtgaatatatagcaggtggagttgat
tctcctgtgcgtgcctttgctagcgtaggtagcaatcctttatttatcaaacaaggaaaa
ggtgcttatattagtgatatagaagataatacttatatagattatgtacaaagttgggga
cctttgctttttgggcattgtgatgaagatattgaaaaagcttgtaaaaaagctttagaa
catggctcaagctttggtgcaccaaccctagctgaaactaaattggccaaatttatctta
aaagattggccacatttagacaaaatccgttttgtaagcagtggcacagaagctactatg
agcgctattcgtcttgcaagaggatttagcaaaaaagataaaatcatcaaatttgaagga
tgttatcatgggcattctgattctttattagtaagcgctggaagtggtgcagctactttt
aacaccccaagctcactaggagtattaaccgatgtagctaaaaatactctagtggctatt
tataatgacattgaaagtgttaaaaacttaatcaataatgatgataatatagcttgtatc
attatagagccaattgcagggaacatgggcttagtacctgctaaaatagaatttttacaa
gagctaagaaaactatgtgatgagcatcaaattcttttgatttttgatgaagttatgagt
ggctttagagcttcatacctaggctcttttggaattaataatataaaagctgatatagta
acttttggtaaggttataggcggaggtatgcctgcggctgcttttgccgcaagggctgag
attatggatttattaagtcctttgggcggggtatatcaagcaggaacactaagcggtaat
cctcttgctatggctgcaggttatgcaagtttaaaaaaagcaagaaattgtgaaggttta
tatgaaaaattagaaaaactaggcaaaagacttactcaaggctttaaagaagctgcaaat
gattgcaaaattcctttgcaagttaattgcattggttctatgtttggatttttcttttgt
gaaaaccctgttaataattatcaagatgctttaaaatcagatactaaattatttgctaaa
tttcatgcacaaatgctaagcaaaggcgtgtatttagcaccatctcaatttgaaacaggt
tttatatgtgaatgtatggataaaaaaatcattgataaaaccatacaagcagcacaagaa
agttttaaagccctatga

DBGET integrated database retrieval system