KEGG   Campylobacter lari RM16712: UPTC16712_0648Help
Entry
UPTC16712_0648    CDS       T03556                                 

Gene name
ackA
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
clm  Campylobacter lari RM16712
Pathway
clm00430  Taurine and hypotaurine metabolism
clm00620  Pyruvate metabolism
clm00640  Propanoate metabolism
clm00680  Methane metabolism
clm01100  Metabolic pathways
clm01120  Microbial metabolism in diverse environments
clm01200  Carbon metabolism
Module
clm_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:clm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    UPTC16712_0648 (ackA)
   00640 Propanoate metabolism
    UPTC16712_0648 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    UPTC16712_0648 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    UPTC16712_0648 (ackA)
Enzymes [BR:clm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     UPTC16712_0648 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AJD06162
UniProt: A0A0A8I8F0
Position
622775..623959
Genome map
AA seq 394 aa AA seqDB search
MKILVLNSGSSSIKFKLFEKDEALASGLVEKIGEQSSKIELKDLKSGQKYQKELAIKDHE
QGIELVNELFAQSGILHDLNELDGCGHRIVHGGPNLTKHCLVDDEILKEIDRVAHIAPLH
NPAHLIGIKTMIKAAPKVPNVTVFDTAFHQSMPDYAYMYALPYEFYEKHQVRKYGFHGTS
HSYVSKQAAHILGKNINEFNAISAHLGNGASVCAIENGKCVDTSMGFTPLEGLIMGTRCG
DIDPAVLPFLAKELNLNPSDLDTIMNKKSGVYGICGFNDFRDIEAQIEENNEKARLALDM
FCYRLSKYIGSYFAILPRVDALIFTAGIGENDSIVRAKVCQKLAHLGFDIDLDKNAQLRN
GEISKKDSKIKILIVPTEEELEIAKITTELIKNK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattagttttaaattcaggttcatcttcaattaaatttaagctttttgaaaaa
gatgaagccttagcatctggtttagtggaaaaaataggcgagcaaagctctaaaatagaa
ctaaaagatctaaaaagtgggcaaaaataccaaaaagaattagcgattaaagatcatgag
caaggtattgaattggtaaatgaactatttgctcaaagtggaattttacatgatttaaat
gagcttgatgggtgtggacataggatagttcatggaggtccaaatttaaccaaacattgt
ttagtagatgatgaaattttaaaagaaattgatagagttgctcacatagcacctttacat
aatcctgcgcatttaataggtattaaaactatgataaaagccgctccaaaagttcctaat
gtgacagtttttgacacagcttttcatcaaagcatgcctgattatgcttatatgtatgct
ttgccttatgagttttatgaaaaacaccaagtaagaaaatacggctttcacggtacatca
cattcttatgtaagcaagcaagctgcacatatacttggtaaaaatattaatgaatttaat
gcaattagcgctcatcttggaaatggtgcgagtgtttgtgctatagaaaatgggaaatgt
gtagatacttctatgggttttacaccattagaaggtttgattatgggaactagatgtgga
gatattgatcctgctgtattgccatttttagcaaaagaattaaatttaaatccatctgat
ttagatactataatgaataaaaaaagtggtgtttatggaatttgtgggtttaatgacttt
agagatattgaagcgcaaattgaagaaaacaacgaaaaagcaagacttgctcttgatatg
ttttgttatcgtttgagtaaatatattggctcatattttgcgattttacctagagtcgat
gcgttgatttttacagctggtattggagaaaatgacagtattgttagagcaaaagtttgt
caaaaactagcacatttgggatttgatatagatttagataagaatgcacaacttagaaat
ggtgagattagtaaaaaagactctaaaattaaaattttaattgttccaacagaagaagaa
ttagaaatagctaaaattaccacagagcttattaaaaataaataa

DBGET integrated database retrieval system