KEGG   Campylobacter lari RM16712: UPTC16712_0739Help
Entry
UPTC16712_0739    CDS       T03556                                 

Gene name
metS
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
clm  Campylobacter lari RM16712
Pathway
clm00450  Selenocompound metabolism
clm00970  Aminoacyl-tRNA biosynthesis
clm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    UPTC16712_0739 (metS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    UPTC16712_0739 (metS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:clm01007]
    UPTC16712_0739 (metS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:clm03016]
    UPTC16712_0739 (metS)
Enzymes [BR:clm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     UPTC16712_0739 (metS)
Amino acid related enzymes [BR:clm01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   UPTC16712_0739 (metS)
Transfer RNA biogenesis [BR:clm03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    UPTC16712_0739 (metS)
 Prokaryotic type
   Other AARSs
    UPTC16712_0739 (metS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Zn_Tnp_IS91 zinc-ribbons_6 Anticodon_1 DUF2935 Zn-ribbon_8
Motif
Other DBs
NCBI-ProteinID: AJD06252
UniProt: A0A0A8I8Q2
Position
719333..721219
Genome map
AA seq 628 aa AA seqDB search
MRYITTPIYYVNDVAHIGHAYTTIIADTLARFYRLQGEKTFFLTGTDEHGQKIEQAASAR
NFTPKEYADEISSKFKKLWDEFEISYDYFIRTTDENHKLSVQKAFKKMFDKGDIYKGTYE
GFYCVSCESYFTQTQLVNECHCPDCGKKTQLLKEESYFFKLSKYQDQILKWYKEKEPILP
KNKANELIHFVEGGLKDLSITRTSFEWGIKLPKELNDEKHVVYVWLDALMNYVSALGYGL
DDKNMDLWPAHIHFVGKDILRFHAVYWPAFLMSLELPLPKFVAAHGWWTKDGEKMSKSKG
NVVAPKEVADTFGLEAFRYFLLREVPFGNDGDFSQKALVTRINAELSNELGNLLNRIIGM
SAKYSQNIIECKDVNLYFNQELNECKEYLDNAINALENIQPNRYLEELFKALSLANLSIS
KYEPWNLIKNNQMQKANALVALCANILTKVTILLSAAMPKTALKIAKALNFEISNENYQK
LILNNQLCDLKSSACEALFPKVELTQESKKEEKVEEKPSLSQIKIDDFKKIEIKVALVKD
CQNIEGSEKLLKFQLELENGELRQVLSGIAKFYKASELIGKQVCVITNLKKAKIFGHESQ
GMILSAQKDEKLVLISPQSFIENGALIG
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatattactactccgatatattatgtaaatgatgtggcacacataggtcatgct
tacactacgattatagcagatactttggctagattttatcgcttgcagggagaaaaaaca
ttctttttaacaggtacagatgagcatggccaaaagatagagcaagctgctagcgctaga
aattttacccctaaagaatatgcagatgaaattagttctaagtttaaaaaactttgggat
gagtttgaaatttcttatgattatttcattagaactacagatgaaaaccacaaattaagt
gtgcaaaaagcatttaaaaaaatgtttgataagggtgatatttataaaggtacctatgaa
ggcttttattgtgtttcttgtgagagttattttactcaaactcagcttgtaaatgagtgt
cattgtccagattgtggtaaaaaaacacagcttttaaaagaagaaagttattttttcaag
ctttctaaatatcaagatcaaattcttaaatggtataaagaaaaagagccgattttacct
aaaaataaggctaatgaattgatccactttgtagaaggtggcttaaaagatctttctatc
acaagaacgagttttgagtggggtataaagcttccaaaagagctaaatgatgaaaaacat
gtggtatatgtttggcttgatgctttgatgaattatgtgagtgcattaggttatggactt
gacgataaaaatatggatctttggcctgctcatattcattttgtaggtaaggatatcttg
cgttttcatgcagtgtattggcctgcatttttgatgagtttagaacttcctttacctaaa
tttgtagcagcacatggttggtggactaaagatggtgaaaaaatgagcaaatctaaaggc
aatgtagtagcacctaaagaagtagcagatacttttggtttagaagcttttagatatttt
ttactcagagaagtcccttttggtaatgatggggatttttcacaaaaagcattagtcact
agaatcaatgcagaattaagcaatgagcttggaaatttattaaatagaattatcggcatg
agtgctaagtattctcaaaatattattgaatgcaaagatgtgaatttgtattttaatcaa
gaattaaatgaatgcaaagagtatttagataatgcaatcaatgctttagaaaatatccag
ccaaatcgttatttagaagagcttttcaaggctttatctttagcaaatttaagtattagt
aaatatgagccttggaatttaattaaaaataatcaaatgcaaaaagctaatgctttagtg
gctttatgtgctaatattttaacaaaagttactattttactttcagctgctatgccaaaa
acagctttaaaaattgccaaagctttaaattttgaaatttcaaatgaaaattaccaaaaa
ttaattttaaataatcaattgtgtgatttaaaatcaagtgcatgtgaagctttatttcca
aaagttgaattaacccaagaaagtaaaaaagaagaaaaagtagaagaaaagccaagtttg
tctcaaattaaaattgatgattttaaaaaaattgaaattaaagtagcattagtaaaagat
tgtcagaatatagaaggcagcgaaaagcttttaaaatttcaacttgagcttgaaaatggt
gagttaagacaagtactttctggtattgctaaattttataaagctagtgaattaataggt
aagcaagtttgtgtcattaccaatctaaaaaaagctaaaatttttggccatgaaagtcaa
ggtatgattttaagtgcccaaaaagatgaaaaattagttttaattagcccacaaagcttt
attgaaaatggagctttaataggctag

DBGET integrated database retrieval system