KEGG   Campylobacter lari RM16712: UPTC16712_0927Help
Entry
UPTC16712_0927    CDS       T03556                                 

Definition
(GenBank) inorganic phosphate transporter, PitA family
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
clm  Campylobacter lari RM16712
Brite
KEGG Orthology (KO) [BR:clm00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    UPTC16712_0927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 RTX_C SDH_sah
Motif
Other DBs
NCBI-ProteinID: AJD06434
UniProt: A0A0A8I7T5
Position
complement(921066..922586)
Genome map
AA seq 506 aa AA seqDB search
MSKDNAIAFFIFIVSVLCFFVWGYNYIPNNSMILFILASVFGIFMAFNVGGNDVANSFGT
SVGAKTVTIKQALIIAAVFELSGAVFAGGEVTNTIRSGIVVLPDGINPMVFVCVMLSALL
SSGIWLFVATKKGLPVSTTHSIIGGIVGSSIAMGFVFFDQDQALSMVNWNGIYKIAMSWV
ISPLLGGLVAYLIYAYIYKKILKPSEEITLVVKEIKKEKKAFKEEYFKNLKNKSQEEQIK
ELSAIVLDDDEKRSEYKLKIKELKEKEKNIDVFSRMKFHVPLIAGVGALTIASMFLFKGL
NNVSTLDVMQNLWIVSIISIFAYIVTLAVVRLMKKTQVNKTIEKIFSWFQIFTASSFAFS
HGANDIANALGPFAAILDVLKNNTINPSSPVPFAVMLMFGIALVIGLWFLGKEVIQTVGS
KLAEIKPTTGFSAELGASIVILLATQLGIPVSSTHILIGAILGIGVFNKDAKWAMMKPIG
LAWVITLPVAGILSSIIFIIFVNTIL
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaaagataatgctattgcattttttatttttattgtgagtgttttatgctttttt
gtttgggggtataattatattcctaataattccatgatattatttatccttgctagcgta
tttggtattttcatggcctttaatgtcggtggtaatgatgttgcaaattcatttggtact
agcgtgggtgctaaaacagttactataaaacaagctttgattattgcagcggtatttgaa
ttaagtggggctgtatttgcaggtggggaagtaaccaatactataagaagtggtatagta
gttttacctgatggaattaatcccatggtatttgtatgcgtaatgctctcagctttgcta
agttcaggaatttggctttttgtagcgactaaaaaaggacttccagtttctaccactcat
agtattataggaggtattgtaggctcaagtattgctatgggctttgtattttttgatcaa
gatcaagcattatctatggtaaattggaatggtatttataaaatagctatgagttgggtt
atttcgcctttgcttggcgggcttgtggcgtatttaatttatgcttatatttataaaaaa
atcttaaagccatcagaggaaataactcttgtggtaaaagaaattaaaaaagaaaaaaaa
gcatttaaagaagaatattttaaaaatttaaaaaacaaaagccaagaagagcaaatcaaa
gaacttagtgctattgttttagatgatgatgaaaaaagaagtgaatataagttaaaaatc
aaagaattaaaagaaaaagaaaaaaacatagatgttttctcaagaatgaaatttcatgtt
cctttaatagcaggtgtaggtgcattgactattgcttctatgtttttatttaagggttta
aataatgtttctactttagatgtaatgcaaaatttatggatagtttcgatcatttctatt
tttgcttatattgttactttagcagtcgtgaggttgatgaaaaaaacgcaggttaataag
accatagaaaagattttttcgtggtttcaaatttttactgcttcaagttttgctttttca
catggagctaatgatatagctaatgctcttggaccatttgctgctattttagatgtactt
aaaaacaacaccattaatcctagctcaccagtgccttttgctgtgatgcttatgtttggt
atagctttggttattgggctttggtttttaggtaaagaagttattcaaactgtgggttca
aaacttgctgaaattaaaccaacaacaggctttagtgctgaacttggtgcaagtattgtt
atacttttagctacccaacttggaattccagttagctcaacccatattttaatcggtgct
attttaggtataggggtatttaataaagatgctaaatgggctatgatgaagcctattggt
ttagcatgggtgattaccttaccagttgctggaattctttcaagtattatttttattatc
tttgtaaatacaatcttatga

DBGET integrated database retrieval system