KEGG   Campylobacter lari RM16712: UPTC16712_1327Help
Entry
UPTC16712_1327    CDS       T03556                                 

Gene name
ndk
Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
clm  Campylobacter lari RM16712
Pathway
clm00230  Purine metabolism
clm00240  Pyrimidine metabolism
clm01100  Metabolic pathways
clm01110  Biosynthesis of secondary metabolites
clm01130  Biosynthesis of antibiotics
Module
clm_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
clm_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
clm_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:clm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    UPTC16712_1327 (ndk)
   00240 Pyrimidine metabolism
    UPTC16712_1327 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:clm04131]
    UPTC16712_1327 (ndk)
Enzymes [BR:clm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     UPTC16712_1327 (ndk)
Membrane trafficking [BR:clm04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    UPTC16712_1327 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AJD06825
UniProt: A0A0A8IB57
Position
1316868..1317281
Genome map
AA seq 137 aa AA seqDB search
MEKTLSIIKPDAVKKGVIGQILTRFESNGLRIAATKKIQLSEKEAQEFYAVHKDRPFFKD
LVEFMISGPVVVSVLEGENAVLKNRELMGATNPKEAAPGTIRADFADSIDANAVHGSDSL
ENAKIEIEFFFSKTEIL
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaaacactttctattattaaacctgatgcagttaaaaaaggtgttattggtcaa
attttaacacgctttgaaagcaatggtctaagaatagcagcaacaaaaaaaatacagctt
tcagaaaaagaagctcaagaattttacgctgtacacaaagacagaccttttttcaaagat
ttagttgaatttatgatcagtggtccagttgtggtttctgttttagaaggcgaaaatgct
gtattaaaaaacagagaattaatgggtgctacaaatccaaaagaagcagctcctggtact
attagagcagattttgcagatagtattgatgcaaatgcggttcatggaagcgatagcttg
gaaaatgcaaaaattgaaatagaatttttcttttcaaaaactgaaattttataa

DBGET integrated database retrieval system