KEGG   Campylobacter lari NCTC 11845: UPTC3659_0609Help
Entry
UPTC3659_0609     CDS       T03552                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase, proenzyme
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
cln  Campylobacter lari NCTC 11845
Pathway
cln00564  Glycerophospholipid metabolism
cln01100  Metabolic pathways
cln01110  Biosynthesis of secondary metabolites
Module
cln_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:cln00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    UPTC3659_0609 (psd)
Enzymes [BR:cln01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     UPTC3659_0609 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AJD01463
UniProt: A0A0A8HUR0
Position
595130..595939
Genome map
AA seq 269 aa AA seqDB search
MGFSNSASKMFGIIAKYKFPKIIQKNINKAYVNAFNINMSEFKSLEEYESLNALFTRTLL
NERELEDGFVSPSDGKILELGSSFQNDLKENLAFSIKGSSYSIEELLKNSASKEELENGI
DYANIYLSPKDYHHYHAPCNMQILSATYMSGALFSVSEAKLAKIINLYTKNERVVLKCLV
EGKFILWMVFVGALNVGKMHFSFDTSIQTNAANFDFTHTYEDLFVKKGQRLGNFELGSTI
VLIAQKGFLKFSKNAYEQVEFSKKIADFA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
gtgggatttagcaatagtgcttcaaaaatgtttggaattatagcaaaatataaatttcca
aaaattatacaaaaaaacattaataaagcttatgtaaatgcttttaatatcaatatgagt
gaatttaagtctttagaagaatacgagagtttaaatgctttgtttacaagaactttatta
aatgagcgagaattagaagatggctttgtaagtccaagtgatggtaaaattttagaactt
ggaagtagttttcaaaatgacttaaaagaaaatttagcctttagcattaaaggttcaagt
tatagtatagaagagcttttaaaaaactcagccagtaaagaagaattagaaaatggcata
gattatgcaaatatttatttatctccaaaagattatcatcattatcatgcaccttgtaat
atgcaaattttaagtgctacttatatgagtggggctttatttagtgtgagtgaggcaaag
ttagccaagattataaatctttatactaaaaatgaaagagtagttttaaagtgcttagtg
gaaggaaaatttatactttggatggtatttgtgggcgcgctaaatgttggtaaaatgcat
tttagctttgatactagtatacaaactaacgctgcaaattttgattttactcatacttat
gaagatctttttgtaaaaaaaggccaaagacttggaaattttgagctaggttcaactata
gttttaatcgctcaaaaagggtttttaaaatttagcaaaaatgcttatgagcaagttgaa
ttttctaagaagattgcggattttgcttag

DBGET integrated database retrieval system