KEGG   Mageeibacillus indolicus: HMPREF0868_1197Help
Entry
HMPREF0868_1197   CDS       T01181                                 

Definition
(GenBank) site-specific recombinase, phage integrase family
Organism
clo  Mageeibacillus indolicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_integrase Phage_int_SAM_5 Phage_integr_3
Motif
Other DBs
NCBI-ProteinID: ADN43924
UniProt: E1PK69
Position
555243..556133
Genome map
AA seq 296 aa AA seqDB search
MDILKKDKLGVRSIDSIKPSDAKEWAIRMSENGYAYQTINNYKRSLKASFYIAIQDDCVR
KNPFDFQLKAVLDDDTVPKTVLTEEQEEKLLAFAKADKTYSKNYDEILILLKTGLRISEF
GGLTLPDLDFENRLVNIDHQLLRDTEIGYYIETPKTKSGERQVPMVEEAYQAFKRVLANR
KNDKRVEIDGYSDFLFLNRKNYPKVASDYNGMMKGLVKKYNKYNEDKLPHITPHSLRHTF
CTNYANAGMNPKALQYIMGHANIAMTLNYYAHATFDSAMAEMKRLNKEKQQERLVA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggatattttgaagaaagacaagttaggtgtaagaagtattgacagtattaagccatca
gacgctaaagaatgggctattagaatgagtgaaaatggttatgcttatcaaaccatcaat
aactacaaacgttctttaaaggcttcattctatattgctatacaagatgattgtgttcgg
aagaatccatttgactttcaactgaaagcagttcttgatgatgatactgtccctaagacc
gtactaacagaagaacaggaagaaaaactgttagcctttgcaaaagctgataaaacctac
agcaaaaattatgatgaaattctgatactcttaaaaacaggtcttcgtatttcagagttt
ggtggtttgacacttccagatttagattttgagaatcgtcttgtcaatatagaccatcag
ctattgagagatactgaaattgggtactacattgaaacaccaaagaccaaaagtggcgaa
cgtcaagttcctatggttgaagaagcctatcaagcatttaagcgagtgttagcgaatcga
aagaatgataagcgtgttgagattgatggatatagtgatttcctctttcttaatagaaag
aactatccaaaagtggcaagtgattacaacggcatgatgaaaggtcttgttaagaaatac
aataagtataacgaggataaattgccacacatcactccacatagtttgcgacatacattc
tgtaccaactatgcaaatgcaggaatgaatccaaaggcattacagtacattatgggacat
gctaatatagccatgacgctgaactattacgcacatgcaacattcgattctgcaatggca
gaaatgaaacgcttgaataaagagaagcaacaggagcgtcttgttgcttag

DBGET integrated database retrieval system