KEGG   Mageeibacillus indolicus: HMPREF0868_1198Help
Entry
HMPREF0868_1198   CDS       T01181                                 

Definition
(GenBank) DNA binding domain, excisionase family
Organism
clo  Mageeibacillus indolicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tn916-Xis HTH_17 RelB_N RWP-RK
Motif
Other DBs
NCBI-ProteinID: ADC90371
UniProt: D3R2S2
Position
554630..554833
Genome map
AA seq 67 aa AA seqDB search
MKQTDIPIWERYTLTIEEASKYFRIGENKLRRLAEENKNANWLIMNGNRIQIKRKQFEKI
IDTLDAI
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagactgacattcctatttgggaacgttataccctaaccattgaagaagcgtca
aaatattttcgtattggcgaaaacaagctacgacgcttggcagaggaaaataaaaatgca
aattggctgattatgaatggcaatcgtattcagattaaacgaaaacaatttgaaaaaatt
atagatacattggacgcaatctag

DBGET integrated database retrieval system