KEGG   Mageeibacillus indolicus: HMPREF0868_1199Help
Entry
HMPREF0868_1199   CDS       T01181                                 

Definition
(GenBank) hypothetical protein
Organism
clo  Mageeibacillus indolicus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADC90905
UniProt: D3R2S3
Position
complement(554233..554361)
Genome map
AA seq 42 aa AA seqDB search
MAVSSVGSFLIETYSITFIQFSKNNGSLAYQNTLKAQYALVE
NT seq 129 nt NT seq  +upstreamnt  +downstreamnt
atggcggttagttccgttggctcttttcttatcgaaacgtattcgattacttttattcag
ttttcaaagaacaatggctcgttagcctatcaaaacacattgaaagctcaatatgctttg
gtggaataa

DBGET integrated database retrieval system